Align SDR family oxidoreductase (characterized, see rationale)
to candidate H281DRAFT_03529 H281DRAFT_03529 2-keto-3-deoxy-L-fuconate dehydrogenase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Burk376:H281DRAFT_03529 Length = 247 Score = 339 bits (869), Expect = 4e-98 Identities = 176/252 (69%), Positives = 205/252 (81%), Gaps = 8/252 (3%) Query: 5 TGRLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAG--VETHLLD 62 T RLAGKT LITAA QGIG A+ E+FAREGARVIATDI + +AG VE LD Sbjct: 2 TQRLAGKTALITAAGQGIGLATAEMFAREGARVIATDI------RIDGLAGKPVEARKLD 55 Query: 63 VTDDDAIKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIRAVLP 122 V D +AIKAL A+VG +DVLFNCAG+V AG+ILEC ++ WDF+F+LNAKAM+ IRA LP Sbjct: 56 VLDGEAIKALAAEVGPIDVLFNCAGFVHAGSILECSEEDWDFAFDLNAKAMYRMIRAFLP 115 Query: 123 GMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNAICPG 182 ML + GSI+N++SAASSVKGV NRFAY ASKAAV+GLTKSVAADFV++G+RCNAICPG Sbjct: 116 AMLERGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFVTRGVRCNAICPG 175 Query: 183 TIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDESNFTT 242 T+ SPSL QRI+ QA G + + V+AAFVARQPMGRIGKAEE+AALALYLASDES FTT Sbjct: 176 TVSSPSLEQRIAAQAAAQGATLEAVQAAFVARQPMGRIGKAEEIAALALYLASDESAFTT 235 Query: 243 GSIHMIDGGWSN 254 G H+IDGGWSN Sbjct: 236 GHAHVIDGGWSN 247 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 247 Length adjustment: 24 Effective length of query: 230 Effective length of database: 223 Effective search space: 51290 Effective search space used: 51290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory