Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate H281DRAFT_06500 H281DRAFT_06500 Lactate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >FitnessBrowser__Burk376:H281DRAFT_06500 Length = 308 Score = 185 bits (469), Expect = 1e-51 Identities = 113/263 (42%), Positives = 144/263 (54%), Gaps = 10/263 (3%) Query: 46 VDALVTLVTDKVDKELLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATA 105 ++A++T + +V LL + P LKIIA VG+D I ++ A RG+ VTNTPGVL A Sbjct: 42 IEAILTRSSYQVPASLLASLPNLKIIATSGVGFDGIPLDAARSRGVIVTNTPGVLDAAVC 101 Query: 106 DLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQAL 165 +LA LLL++ RRI AD FVR W H L L L GK +GIVG GRIGQ + Sbjct: 102 ELAIGLLLSLLRRIPSADRFVRDEAWA------HELFPLTSSLAGKRIGIVGLGRIGQGI 155 Query: 166 AKRAKGFGMKIIYYSRTRKPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMIGEK 225 A+R GF ++I Y + E A D L +D + + P T H+I Sbjct: 156 ARRLAGFDVEIAYCGS----KVEGLPYAMISDVRELASFADILIVCCPGGDRTRHLIDGA 211 Query: 226 ELKLMKPNAILINTSRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVL 285 L + + L+N SRG VVD ALI AL++G I GA LDVFE+EP L L NVVL Sbjct: 212 VLSALGSSGFLVNVSRGTVVDEAALIDALEKGLIRGAALDVFEKEPLIGSRLATLSNVVL 271 Query: 286 APHIGSATHEAREGMAELVAKNL 308 PH GSAT E R M L N+ Sbjct: 272 TPHAGSATEETRHTMLRLALDNI 294 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 308 Length adjustment: 28 Effective length of query: 303 Effective length of database: 280 Effective search space: 84840 Effective search space used: 84840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory