Align Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 (characterized)
to candidate H281DRAFT_01054 H281DRAFT_01054 (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase
Query= SwissProt::Q00796 (357 letters) >FitnessBrowser__Burk376:H281DRAFT_01054 Length = 356 Score = 169 bits (428), Expect = 1e-46 Identities = 108/321 (33%), Positives = 174/321 (54%), Gaps = 18/321 (5%) Query: 15 HGPGDLRLENYPIPEP-GPNEVLLRMHSVGICGSDVHYWEYGRIGNFIV----------K 63 H D+R+EN P P G ++++++ GICG+D+H ++ G I +V K Sbjct: 7 HCAHDIRVENVPDPSGIGADQMIVKPMWCGICGTDLHEYQAGPI---VVPTEPHPLTGAK 63 Query: 64 KPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATP 123 P VLGHE S V +VG VK+++ GDR+++ P A +C G +L + Sbjct: 64 APQVLGHEFSAEVLEVGRDVKNVRAGDRISVMPLASCGQCYYCVRGMRHLCTKMGCVGLS 123 Query: 124 PDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGP 183 D G + + N +LPDNV+ ++GALIEP +V ++A RGGVT+G VL+ GAGP Sbjct: 124 WDGGGMAEYTVLNDYHANRLPDNVSDKQGALIEPAAVALYAVDRGGVTVGSSVLITGAGP 183 Query: 184 IGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQL-GC 242 IG++ L A GA+Q+ V++ + R +K E G + QI + E+ ++ G Sbjct: 184 IGVLAALACHAAGASQIFVSEPNPARAAKMSEFG--VTTQIFDPTEGELPERIRDLTEGV 241 Query: 243 KPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCN 302 +V IEC+G + ++ A + A RS G +V GL TV + +++++ I+G + Y Sbjct: 242 GVDVAIECSGNQHALNACVDAVRSAGAVVQAGLHVGTATVDPMKWSLKDIHIEGTWCYPV 301 Query: 303 T-WPVAISMLASKSVNVKPLV 322 T WP I M+A+ V+ L+ Sbjct: 302 TIWPRIIGMIANGKFPVEKLI 322 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 356 Length adjustment: 29 Effective length of query: 328 Effective length of database: 327 Effective search space: 107256 Effective search space used: 107256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory