Align Xylonolactonase (EC 3.1.1.68) (characterized)
to candidate H281DRAFT_05978 H281DRAFT_05978 Sugar lactone lactonase YvrE
Query= reanno::Korea:Ga0059261_1893 (295 letters) >FitnessBrowser__Burk376:H281DRAFT_05978 Length = 303 Score = 174 bits (440), Expect = 3e-48 Identities = 93/272 (34%), Positives = 137/272 (50%), Gaps = 1/272 (0%) Query: 20 EGPVWVQRDAALWFVDIKSHRIHRFDPASGERRSWDAPAQVGFCLPAANGKFVAGLQTGL 79 E +W ++ LW+VD IHR D +SG ++SW ++G A G + G+++G Sbjct: 29 ESIIWDEKTQLLWWVDGIGQSIHRLDISSGAKKSWPMQEEIGSIGLRAKGGLIVGMRSGF 88 Query: 80 AIFDPADRSFTPLTDPEPALPGNRLNDGTVDPAGRLWFGTMDDGESEATGRIYRLGGDGR 139 F P T + P+ P NR NDG D GR W GT++ GR++RL D + Sbjct: 89 YFFSPETGELTEVARPDAERPKNRFNDGKCDRHGRYWSGTVEAAAYTPRGRLFRLDPDLK 148 Query: 140 CVAETAAVSISNGPAVSPDGRTLYHVDTLGGVIHSAAIGD-DGILGDSRVFATIPNSEGF 198 ++ NG + SPD R +Y D+ I DG + + R FA +P G Sbjct: 149 PKLIMEGITCINGLSFSPDNRLMYMTDSFSCQIDVFDYDSVDGAIYNRRKFAEVPLGRGI 208 Query: 199 PDGPAVDAEGCVWIGLYNGAAVRRYSPAGELLDVVAFPVGAITKVAFGGPDLRTVYATTA 258 DG VDA+GC W +G V RY P G + V+ PV ++ + FGGPDL T++ TTA Sbjct: 209 CDGSTVDADGCFWSANMDGWCVTRYDPRGRIDMVINLPVRRVSSLCFGGPDLDTLFITTA 268 Query: 259 SKHLDADGRAEEPHAGDLFAFRVSVPGMPGTE 290 + + A++P AG++ A R V G+P E Sbjct: 269 RRRMSEKELAQQPLAGNVLAVRPGVKGLPEPE 300 Lambda K H 0.319 0.139 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 303 Length adjustment: 27 Effective length of query: 268 Effective length of database: 276 Effective search space: 73968 Effective search space used: 73968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory