GapMind for catabolism of small carbon sources

 

Protein CCNA_02751 in Caulobacter crescentus NA1000

Annotation: FitnessBrowser__Caulo:CCNA_02751

Length: 332 amino acids

Source: Caulo in FitnessBrowser

Candidate for 87 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism PA5503 hi Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 65% 100% 413.7 Methionine import ATP-binding protein MetN; EC 7.4.2.11 51% 303.9
L-asparagine catabolism aatP med ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 48% 98% 203.4 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-aspartate catabolism aatP med ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 48% 98% 203.4 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-glutamate catabolism gltL med ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) 48% 98% 203.4 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-arginine catabolism artP med histidine transport ATP-binding protein hisP (characterized) 47% 95% 197.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-histidine catabolism hisP med histidine transport ATP-binding protein hisP (characterized) 47% 95% 197.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-lysine catabolism hisP med histidine transport ATP-binding protein hisP (characterized) 47% 95% 197.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 43% 92% 190.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 43% 92% 190.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-histidine catabolism bgtA med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 44% 97% 186.4 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-alanine catabolism Pf6N2E2_5405 med ABC transporter for D-Alanine, ATPase component (characterized) 43% 94% 186 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-histidine catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 44% 82% 186 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-proline catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 44% 82% 186 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-asparagine catabolism glnQ med Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 41% 97% 182.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-asparagine catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 42% 98% 182.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-aspartate catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 42% 98% 182.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-histidine catabolism BPHYT_RS24015 med ABC transporter related (characterized, see rationale) 42% 97% 182.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-citrulline catabolism PS417_17605 med ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 44% 89% 181.4 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-citrulline catabolism AO353_03040 med ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 41% 97% 180.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-histidine catabolism aapP med ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 42% 92% 179.9 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 42% 60% 192.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 92% 176 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 92% 176 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 92% 176 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 92% 176 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 92% 176 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 40% 95% 174.1 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 37% 68% 174.1 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 37% 58% 171.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 39% 91% 171.4 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 39% 91% 171.4 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 65% 162.9 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 65% 162.9 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 65% 162.9 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 65% 162.9 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 36% 80% 160.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 67% 151 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 67% 151 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 34% 86% 150.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 35% 62% 150.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 35% 70% 149.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 37% 64% 148.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 37% 64% 148.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-cellobiose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 34% 75% 145.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-glucose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 34% 75% 145.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
lactose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 34% 75% 145.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-maltose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 34% 75% 145.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
sucrose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 34% 75% 145.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
trehalose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 34% 75% 145.6 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-sorbitol, ATPase component (characterized) 33% 84% 144.1 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 31% 82% 143.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 37% 80% 143.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 32% 82% 142.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 33% 73% 142.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 37% 57% 141.7 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 38% 72% 139.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 35% 69% 139.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 32% 69% 139 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 32% 71% 137.9 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 36% 76% 134 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 38% 78% 132.1 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-isoleucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 34% 93% 131.7 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-leucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 34% 93% 131.7 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 32% 67% 131.7 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-valine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 34% 93% 131.7 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 34% 72% 129.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-alanine catabolism braF lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 35% 90% 127.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-histidine catabolism natA lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 35% 90% 127.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-leucine catabolism natA lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 35% 90% 127.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-proline catabolism natA lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 35% 90% 127.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-serine catabolism braF lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 35% 90% 127.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-threonine catabolism braF lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 35% 90% 127.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-proline catabolism HSERO_RS00895 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 31% 95% 126.7 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-isoleucine catabolism natA lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 35% 87% 123.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-valine catabolism natA lo NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 35% 87% 123.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-phenylalanine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized) 32% 94% 122.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-cellobiose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 87% 121.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-glucose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 87% 121.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
lactose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 87% 121.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-maltose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 87% 121.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
sucrose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 87% 121.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
trehalose catabolism mglA lo glucose transporter, ATPase component (characterized) 33% 87% 121.3 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
citrate catabolism fecE lo iron(III) dicitrate transport ATP-binding protein FecE (characterized) 32% 99% 118.2 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 33% 86% 116.7 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
D-lactate catabolism PGA1_c12640 lo D-lactate transporter, ATP-binding component (characterized) 30% 97% 107.5 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-isoleucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale) 31% 98% 104.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7
L-phenylalanine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale) 31% 98% 104.8 Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN 65% 413.7

Sequence Analysis Tools

View CCNA_02751 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MITFQDVSKTYAQGGHPALSGVSLSVKAGEVFGVIGASGAGKSTLIRLINGLETPSAGQV
IVDGDDVAALGVAGLRALRRRVGMIFQHFNLLSGKTVAQNVAFPLKLAGRPAAEVKARTA
ELLERVGLSAHAGKYPAQLSGGQKQRVGIARALATNPKVLLCDEATSALDPETTEQILDL
IAGLNRELGLTIVLITHEMDVVRRVCDRVAVLDAGRVVEEGAVEEVFLHPASDTARRFVR
EAEGDVTAAPGVGGRVVRLTFKGEATYKPVLGEVARATGVDYSILGGRIHRLRETPYGQL
TLALTGGDVAAAIAQFQAAGVRVDALSGETAQ

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory