Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; EC 2.3.1.9 (characterized)
to candidate CCNA_01168 CCNA_01168 3-ketoacyl-CoA thiolase
Query= SwissProt::Q0AVM3 (396 letters) >FitnessBrowser__Caulo:CCNA_01168 Length = 399 Score = 337 bits (863), Expect = 5e-97 Identities = 179/390 (45%), Positives = 247/390 (63%), Gaps = 10/390 (2%) Query: 12 RTPVGTFGGTLKDVGSAQLGAIVMGEAIKR-AGIKAEQIDEVIFGCVLQAGL-GQNVARQ 69 RTP+G +GG+L V + L AI + + R + IDE++ G QAG +NVAR Sbjct: 11 RTPIGRYGGSLSKVRADDLAAIPLKALVARNPSLDLAAIDEIVLGSANQAGEDNRNVARM 70 Query: 70 CMINAGIPKEVTAFTINKVCGSGLRAVSLAAQVIKAGDADIIMAGGTENMDKAPFILPNA 129 ++ AG P V T+N++C SGL AV AA+ I +G D+++AGG E+M +APF++ A Sbjct: 71 ALLLAGYPVSVPGVTVNRLCASGLEAVGYAARAIASGHNDLVIAGGVESMSRAPFVMGKA 130 Query: 130 RWGYRMSMPKGDLIDEMV-WG----GLTDVFNGYHMGITAENINDMYGITREEQDAFGFR 184 + S ++ D + W + ++ M TAEN+ YG+ RE+QDAF R Sbjct: 131 DSAFSRS---AEIFDTTIGWRFVNPAMRKLYGVDSMPETAENVATDYGVNREDQDAFALR 187 Query: 185 SQTLAAQAIESGRFKDEIVPVVIKGKKGDIVFDTDEHPRKSTPEAMAKLAPAFKKGGSVT 244 SQ AA A +G EI PV I GK G + D DEHPR++T EA+AKL P ++GG+VT Sbjct: 188 SQARAAAAQANGFLAGEITPVEIPGKAGPTIVDRDEHPRETTMEALAKLKPIVREGGTVT 247 Query: 245 AGNASGINDAAAAVIVMSKEKADELGIKPMAKVVSYASGGVDPSVMGLGPIPASRKALEK 304 AGNASG+ND A A+I+ S++ G+ P A++ YAS GV+P VMG+GP+PA RK + K Sbjct: 248 AGNASGVNDGAVALIIASEDAVKRHGLTPRARITGYASAGVEPRVMGIGPVPAVRKLMAK 307 Query: 305 AGLTIDDIDLIEANEAFAAQSIAVARDLGWADKMEKVNVNGGAIAIGHPIGSSGARILVT 364 GL I D D++E NEAFAAQ +AV R LG D VN NGGAIA+GHP+G+SGAR+++T Sbjct: 308 TGLAIGDFDVVELNEAFAAQGLAVLRQLGLPDDGAHVNANGGAIALGHPLGASGARLVLT 367 Query: 365 LLYEMQKRGSKKGLATLCIGGGMGTALIVE 394 L +++ G ++GLATLCIG G G AL E Sbjct: 368 ALRQLEAIGGQRGLATLCIGVGQGAALAFE 397 Lambda K H 0.317 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 399 Length adjustment: 31 Effective length of query: 365 Effective length of database: 368 Effective search space: 134320 Effective search space used: 134320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory