Align BadK (characterized)
to candidate CCNA_02658 CCNA_02658 3-hydroxybutyryl-CoA dehydratase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Caulo:CCNA_02658 Length = 265 Score = 134 bits (337), Expect = 2e-36 Identities = 94/262 (35%), Positives = 134/262 (51%), Gaps = 15/262 (5%) Query: 6 ILTETQGRVGIITLNRPDVLNALN-DALMDALGGALLAFDADDGIGAIVIAGNTRAFAAG 64 ILTE +G + I+TLNRPD +NAL D + A A + D I +++ G +AF+AG Sbjct: 4 ILTEKRGHIAILTLNRPDAMNALGAPGDGDQVAAACEAINDDQDIRCVILTGAGKAFSAG 63 Query: 65 ADIASMAAWSYS---------DVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELAL 115 D+ +M A + D Y N I R I + P +AAV G A G GC++A Sbjct: 64 GDVKAMKAREGAFGGNGVKVRDGYRKN-IHRIVRAIYGLEVPSIAAVNGAAIGLGCDVAC 122 Query: 116 ACDIVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYG 175 DI IA +A+F + +KLGL+PG GG +PR IG ++A ++ + ++A +A +G Sbjct: 123 MTDIRIAADTARFGVTFLKLGLIPGDGGAWLMPRTIGMSRAAELLFTGDVIDAAKAAEWG 182 Query: 176 LVSRVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARF 235 L+S+ V L E +ALA IA AL K L T + L E Sbjct: 183 LISKAVPAGDLMGEALALAERIAQQPPHALRMAKSLLKHG--QTASYDTLMEMSAAAQAI 240 Query: 236 A--SADAREGIQAFLEKRAPCF 255 A + D EG+ A LEKR+P F Sbjct: 241 AHHTEDHMEGVDAILEKRSPVF 262 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 265 Length adjustment: 25 Effective length of query: 233 Effective length of database: 240 Effective search space: 55920 Effective search space used: 55920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory