Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate CCNA_02658 CCNA_02658 3-hydroxybutyryl-CoA dehydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >FitnessBrowser__Caulo:CCNA_02658 Length = 265 Score = 162 bits (411), Expect = 5e-45 Identities = 101/265 (38%), Positives = 146/265 (55%), Gaps = 19/265 (7%) Query: 6 ILVETRGRVGLVTLNRPKALNALN-DALMDELGAALREFDADDAIGAIVVTGSEKAFAAG 64 IL E RG + ++TLNRP A+NAL D++ AA + D I +++TG+ KAF+AG Sbjct: 4 ILTEKRGHIAILTLNRPDAMNALGAPGDGDQVAAACEAINDDQDIRCVILTGAGKAFSAG 63 Query: 65 ADIGMMST---------YTYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAM 115 D+ M D Y+ + I R + + P IAAV G A+G GC++A Sbjct: 64 GDVKAMKAREGAFGGNGVKVRDGYRKN-IHRIVRAIYGLEVPSIAAVNGAAIGLGCDVAC 122 Query: 116 MCDIIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAG 175 M DI AADTA+FG +KLG++PG GG +PR + ++A +L T +DAA+A G Sbjct: 123 MTDIRIAADTARFGVTFLKLGLIPGDGGAWLMPRTIGMSRAAELLFTGDVIDAAKAAEWG 182 Query: 176 LVSRVIPAASLVDEAIAAAATIAEFPSPAVMMVKESVNR----AYETTLAEGVHFERRLF 231 L+S+ +PA L+ EA+A A IA+ P A+ M K + +Y+T + + Sbjct: 183 LISKAVPAGDLMGEALALAERIAQQPPHALRMAKSLLKHGQTASYDTLMEMSAAAQAIAH 242 Query: 232 HSLFATEDQKEGMAAFVEKRKPVFK 256 H TED EG+ A +EKR PVFK Sbjct: 243 H----TEDHMEGVDAILEKRSPVFK 263 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 265 Length adjustment: 25 Effective length of query: 233 Effective length of database: 240 Effective search space: 55920 Effective search space used: 55920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory