Align 3-carboxymuconate lactonizing enzyme type 2 (EC 5.5.1.2) (characterized)
to candidate CCNA_02572 CCNA_02572 adenylosuccinate lyase
Query= metacyc::MONOMER-14208 (453 letters) >FitnessBrowser__Caulo:CCNA_02572 Length = 436 Score = 150 bits (378), Expect = 1e-40 Identities = 121/390 (31%), Positives = 177/390 (45%), Gaps = 11/390 (2%) Query: 23 VFSDSRYISFMFQVEGALARAQAEHGLVPMSLATAIENVQREGLEPSTLARGSELSGVP- 81 ++S F++E A A AE G++P A I R+ + S R E+ V Sbjct: 13 IWSSQTKYKIWFEIEAHAADAMAELGVIPKLAAETIWEKGRDAVWDSD--RIDEIERVTK 70 Query: 82 --TIPFVQAVQAKLPPDLEPYFHFGATTQDIADTARVLQIREALDFLSHDLLATVKNLAS 139 I F+ V + P+ + H G T+ D+ DT +Q+ A D L D+ + L Sbjct: 71 HDVIAFLTHVSEIVGPEAR-FLHQGMTSSDVLDTCFAVQLSRATDLLLEDVDLVLAALKR 129 Query: 140 LAEKHRETPCVARTASQQAAPITFGYKVAGWCVALSEHVEYLQTLRPHILVVSLGGPVGT 199 A +H+ T CV R+ A PITFG K+AG+ E L + I ++ G VGT Sbjct: 130 RALEHKMTVCVGRSHGIHAEPITFGLKLAGYYAEFQRAKERLAMAKFEIATCAISGAVGT 189 Query: 200 LAALGDKGPAVIDSFADILGLRSPPI-TWHTHRARIVETGSWLGILIGILGKIATDIISL 258 A + P V AD +GL P+ T R R + LG++ + ++AT+I L Sbjct: 190 FA---NVDPRVEQHVADKMGLAVEPVSTQVIPRDRHAAYFAALGVVASSVERLATEIRHL 246 Query: 259 SSTEVGEVSEPYEPGRGGSSAMPHKRNPISSMMILAAHGAAPGHVSTLMSSLASLHERPV 318 TEV E EP++PG+ GSSAMPHKRNPI + + V M ++A HER + Sbjct: 247 QRTEVLEAEEPFDPGQKGSSAMPHKRNPILTENLTGLARLVRSAVVPAMENVALWHERDI 306 Query: 319 GAWHAEWHALPALFGLASGALREARRVSGGISVNVARMRENLDLTNGLLFSDAAAAVLS- 377 E P ALR V ++ M +NLD GL+FS L+ Sbjct: 307 SHSSVERGIGPDATIHLDFALRRLAGVIERFNIYPDNMAKNLDKLGGLVFSQRVMLALTH 366 Query: 378 RSMGRKQAHAAVEKAVSDVLAHQGSLLTCL 407 + + R+ A+AAV+ V +G L L Sbjct: 367 KDVSREDAYAAVQGNAMKVWRGEGRFLDFL 396 Lambda K H 0.318 0.131 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 436 Length adjustment: 32 Effective length of query: 421 Effective length of database: 404 Effective search space: 170084 Effective search space used: 170084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory