Align protocatechuate 3,4-dioxygenase β subunit (EC 1.13.11.3) (characterized)
to candidate CCNA_02492 CCNA_02492 protocatechuate 3,4-dioxygenase alpha chain
Query= metacyc::MONOMER-3185 (239 letters) >FitnessBrowser__Caulo:CCNA_02492 Length = 216 Score = 91.3 bits (225), Expect = 1e-23 Identities = 76/226 (33%), Positives = 104/226 (46%), Gaps = 42/226 (18%) Query: 31 RSPRQALVSIPQSISETTGPNFSHLGF--------------GAH------DHDLLLNFNN 70 R Q V Q+ S+T GP F H G GA +H +L + Sbjct: 10 RLDNQDPVLFGQTPSQTVGP-FFHYGLPWKGCADLIGDSEIGARPELFPAEHYVLASPTA 68 Query: 71 GGLPIGERIIVAGRVVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRC 130 G GE I++ G V+D GK V + ++E+WQA+A GRY + F G GR Sbjct: 69 KGEVAGEPIVIEGAVLDADGKAVSDAMIEIWQADAAGRYVDGSSH------SGFIGWGRA 122 Query: 131 LTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHFGISGPSIATKLITQLYFEGDPLIPMC 190 T DG Y F TI+PG +D + HI G+ G + +L T+LYFE D Sbjct: 123 STGEDGVYRFVTIRPGRV------DDQQAPHIAIGVFGRGVIKRLATRLYFEDDAANAAD 176 Query: 191 PIVKSIANPEAVQQLIAKLDMNNANPMDCLAYRFDIVLRGQRKTHF 236 PI+ ++ E Q LIA+ A+RFDIVL+G R+T F Sbjct: 177 PIL-ALVPAERRQTLIARKVGQ--------AWRFDIVLQGDRETVF 213 Lambda K H 0.321 0.140 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 216 Length adjustment: 22 Effective length of query: 217 Effective length of database: 194 Effective search space: 42098 Effective search space used: 42098 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory