Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate CCNA_03235 CCNA_03235 spermidine/putrescine transport ATP-binding protein potA
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >FitnessBrowser__Caulo:CCNA_03235 Length = 381 Score = 160 bits (406), Expect = 3e-44 Identities = 90/253 (35%), Positives = 145/253 (57%), Gaps = 6/253 (2%) Query: 1 MSEAIKQPVSPEGIIQMQGVNKWYGQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCL 60 M I +P+ II + V K +G+ + +++L V +GE L GPSG GK+T +R L Sbjct: 1 MCRGISAMTTPKPIITFENVTKRFGKLAAVDNVSLTVNEGEFFALLGPSGCGKTTLLRML 60 Query: 61 NRLEEHQQGRIVVDGVELTNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRK 120 E +GRI++DG +++N + +R V MVFQ + +FPH+T+ N + V Sbjct: 61 AGFETPTEGRILIDGQDISN----VPPNKRPVNMVFQSYAVFPHMTVADNVAYG-LKVDN 115 Query: 121 MPKRKAEEIAMHYLERVRIPEQAHKYPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSAL 180 +PK + E LE V++ + P QLSGGQ+QRVA+ARAL +P+++L DEP SAL Sbjct: 116 VPKAEREARVAEALELVQLGGLGGRKPDQLSGGQRQRVALARALVKRPRVLLLDEPLSAL 175 Query: 181 DPEMVKEVLDTMIGLAED-GMTMLCVTHEMGFARTVANRVIFMDKGEIVEQAAPNDFFDN 239 D ++ +++ + L E G+T + VTH+ A +A+R M KG + + A P+D ++ Sbjct: 176 DAKLREQMRTELCTLQEKVGITFIMVTHDQDEALALASRCAVMSKGLLQQVATPSDLYEF 235 Query: 240 PQNDRTKLFLSQI 252 P + F+ Q+ Sbjct: 236 PNSRFVADFIGQV 248 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 381 Length adjustment: 27 Effective length of query: 227 Effective length of database: 354 Effective search space: 80358 Effective search space used: 80358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory