GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deh in Caulobacter crescentus NA1000

Align Acetate/haloacid transporter, Dehp2, with a possible atypical topology (characterized)
to candidate CCNA_00025 CCNA_00025 major facilitator superfamily transporter

Query= TCDB::F8SVK1
         (552 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00025 CCNA_00025 major facilitator
           superfamily transporter
          Length = 550

 Score =  573 bits (1477), Expect = e-168
 Identities = 284/535 (53%), Positives = 372/535 (69%), Gaps = 7/535 (1%)

Query: 18  KRVIFASSLGTVFEWYDFYLAGSLAAFISKSFFSGVNPTAAFIFTLLGFAAGFAVRPFGA 77
           + V+ ASS GT FEWYDF++ GSL   ISK+FF+G+N TA +I  L  F  GFA RP GA
Sbjct: 12  RTVVSASSAGTAFEWYDFFIFGSLTQVISKTFFAGLNETAGYIAALALFGVGFAFRPLGA 71

Query: 78  LVFGRLGDMVGRKYTFLITIVIMGLSTCVVGFLPGYAAIGMASPVIFIAMRLLQGLALGG 137
           LVFG++GD  GRK  FL T+++MG +T  + FLP Y   G+ +P++ I +R LQG ALGG
Sbjct: 72  LVFGKIGDQDGRKGAFLATVLLMGGATFAIAFLPTYEQAGIIAPILLIILRCLQGFALGG 131

Query: 138 EYGGAATYVAEHAPANRRGFYTAWIQTTATLGLFLSLLVILGVRTAMGE----DAFGAWG 193
           EYGGAA YVAEH+PAN+RG+ T+W+QT+A  GLF +LLVIL  R  +G+    DAF  WG
Sbjct: 132 EYGGAAIYVAEHSPANKRGWATSWVQTSAAFGLFGALLVILATRWVLGKYVGPDAFDEWG 191

Query: 194 WRIPFVASLVLLGISVWIRMQLHESPAFERIKAEGKTSKAPLSEAFGQWKNLKIVILALI 253
           WRIPF  SL LLGISVW+R++L ESP FE +KAEG+ SKAP +EAFGQW NLK+VILA +
Sbjct: 192 WRIPFAVSLGLLGISVWMRLKLTESPTFEAMKAEGQASKAPYAEAFGQWSNLKLVILAFV 251

Query: 254 GVTAGQAVVWYTGQFYALFFLTQTLKVDGASANILIAIALLIGTPFFLFFGSLSDRIGRK 313
            +   Q  VWYT  FY   F+ + LKVD  + N L+ IA  +   F++ FG LSD++GRK
Sbjct: 252 SMMCAQGAVWYTSFFYVQTFMEKFLKVDPVTINELMMIATAVSAIFYVVFGWLSDKVGRK 311

Query: 314 PIILAGCLIAALTYFPLFKALTHYANPALEAATQKSPIVVIANPDECSFQFNPVGTSKFT 373
           P++L G  +A L YFP F  L   ANPAL  A+ K+P+VV A+P +CS QF+PVG + F 
Sbjct: 312 PVMLGGMTLALLFYFPGFHLLEKAANPALAEASAKAPVVVFADPKDCSLQFDPVGKTAFV 371

Query: 374 SSCDIAKSALSKAGLNYDNVAAPAGTLAQIKVGDTTI--DTYDGKAADAKDAGKA-FDKN 430
           +SCDI KS L+ AG++Y N AAPAG +A +++G   +   +  G   D   A KA  +  
Sbjct: 372 TSCDIVKSTLANAGVSYANEAAPAGAVAVMRIGGAEVLSKSAAGLGKDEVKATKAEVEGR 431

Query: 431 LGTALKAASYPPKADPSQLNWPMTVVILTILVIYVTMVYGPIAAMLVEMFPTRIRYTSMS 490
           +  AL  A YP KADP+++N PM + +L + VI  T ++GP+AA LVE+FPTR+RYT++S
Sbjct: 432 IKAALAGAGYPTKADPARMNMPMILGVLFVFVIAATALFGPLAACLVELFPTRVRYTALS 491

Query: 491 LPYHIGNGWFGGFLPATAFAIVAAKGNIYSGLWYPIIIALATFVIGLLFVRETKD 545
           LPYHIG GW GGF+P  AFAIVAA GNIY+GLWYP    L + +  L  + ETK+
Sbjct: 492 LPYHIGTGWVGGFVPFFAFAIVAAVGNIYAGLWYPFAFTLLSVLTTLFLLPETKE 546


Lambda     K      H
   0.325    0.139    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 901
Number of extensions: 58
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 552
Length of database: 550
Length adjustment: 36
Effective length of query: 516
Effective length of database: 514
Effective search space:   265224
Effective search space used:   265224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory