Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate CCNA_00092 CCNA_00092 short chain dehydrogenase
Query= reanno::ANA3:7024897 (256 letters) >FitnessBrowser__Caulo:CCNA_00092 Length = 296 Score = 126 bits (317), Expect = 4e-34 Identities = 85/255 (33%), Positives = 127/255 (49%), Gaps = 15/255 (5%) Query: 10 LQGKTIFISGGATGIGACLVNAFLEQGAKVAFVDILVEESTQLVADLKQTQPEASVTFYH 69 L GK I+GG +GIG V F+ +GA V D+ E+ L +Q P+ V F Sbjct: 5 LNGKVAVITGGCSGIGLGTVELFVAEGACVVAADLQDEKGRML----EQRFPD-QVRFAR 59 Query: 70 CDLVDIAALKRVIAQVEDDLGPISVLINNAACDQRH-SIDEVTPEYWDQCLNTNLRHYFF 128 CD+ L + +A E G + +L NNA S+ E+T E WD+ +R Sbjct: 60 CDVTADDDLAKTMALAESSFGGLDILFNNAGHGGTPASVPELTAEAWDKTFALLVRGPAM 119 Query: 129 AVQAVRPQMQRLGGGSVINLGSMSWHNRQAGMAGYTASKAGAMGLTRGLAADLGKDKIRI 188 + P MQ+ GGGS+IN S++ G Y+++KA + ++R AA+L KIR+ Sbjct: 120 GMTHALPLMQKRGGGSIINTASIAGLQAGFGPLAYSSAKAAVIHMSRCAAAELSPQKIRV 179 Query: 189 NTLTPGWVMTK---------RQLTHWVDKDTAKHIENNQCIKEYVMPEDIAAMALFLAAD 239 N + PG + T R++ + A Q I + +PEDIAA AL+LA+D Sbjct: 180 NAICPGLIATSIFGASMGLPREVADQMAAQIASIGPKIQPIPKSGLPEDIAAAALYLASD 239 Query: 240 DSKLCTAQNFIVDGG 254 DS+ T + +VDGG Sbjct: 240 DSRFVTGTHIVVDGG 254 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 296 Length adjustment: 25 Effective length of query: 231 Effective length of database: 271 Effective search space: 62601 Effective search space used: 62601 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory