Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate CCNA_00366 CCNA_00366 phosphonates transport ATP-binding protein phnC
Query= uniprot:P0DTT6 (251 letters) >FitnessBrowser__Caulo:CCNA_00366 Length = 264 Score = 118 bits (295), Expect = 1e-31 Identities = 80/250 (32%), Positives = 130/250 (52%), Gaps = 23/250 (9%) Query: 4 LLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVF 63 +L IR K+FG+ +ALD VS+++N+GE++AL+G +G+GKSTL++ I G D G Sbjct: 6 VLSIRAASKTFGSRRALDAVSLDVNRGEMIALIGPSGSGKSTLLRSIDGLQTIDEG---- 61 Query: 64 EGKKVIFNSPNDARS----------LGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLN 113 EG F P AR + I I Q L+ L ++ N+ L +I + Sbjct: 62 EGAITAFGGPVQARGKVSDQVRKARVRIGFIAQQFNLVGRLSLFSNVALGS--LGRIPVV 119 Query: 114 KKKMMEESKKLLDSLQIRIPDINM------KVENLSGGQRQAVAVARAVYFSAKMILMDE 167 + + K+ D+ + + + + LSGGQ+Q A+ARA+ AK+IL DE Sbjct: 120 QGLLGWWPKETRDATMAALHRVGVSEYAAQRANTLSGGQQQRGAIARALVQKAKIILADE 179 Query: 168 PTAALSVVEARKVLELARNLKKK-GLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKE 226 P A+L V ARKV+E+ R+L + GL V++ H + DR+ L G+ ++ Sbjct: 180 PVASLDPVSARKVMEILRDLNQSDGLTVVVTLHQVDYALRYCDRVVALKAGQKVYDGPAS 239 Query: 227 ETNVEEITEV 236 E E++ ++ Sbjct: 240 ELKREKLIDI 249 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 264 Length adjustment: 24 Effective length of query: 227 Effective length of database: 240 Effective search space: 54480 Effective search space used: 54480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory