Align high affinity cationic amino acid transporter 1 (characterized)
to candidate CCNA_00435 CCNA_00435 amino acid transporter
Query= CharProtDB::CH_091324 (622 letters) >FitnessBrowser__Caulo:CCNA_00435 Length = 483 Score = 233 bits (593), Expect = 2e-65 Identities = 154/425 (36%), Positives = 230/425 (54%), Gaps = 20/425 (4%) Query: 15 RRKVVDC----SREESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISF 70 RRK +D + +L + L+ LVALGVG+ +G G+Y L G V AGP +++SF Sbjct: 13 RRKAIDTITAGHADSHQLKKTLSWPHLVALGVGAIVGTGIYTLTG-VGAGLAGPGVILSF 71 Query: 71 LIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVAR 130 LIA A LCY E +P +GSAY YSY +GE A+ GW+LIL Y + ++VA Sbjct: 72 LIAGAVCACAALCYAELSTMIPASGSAYTYSYAAMGEPVAWFVGWSLILEYTLVCAAVAV 131 Query: 131 AWSATFDELIGKPIGEFSRQHMALNAPGVLAQTPDIFAVIIIIILTGLLTLGVKESAMVN 190 WSA L K IG F +A G L P AV I + + GLL LG +ESA VN Sbjct: 132 GWSAHAHGLF-KMIG-FPDALLAGPHQGGLINMP---AVFISMAVAGLLALGTRESATVN 186 Query: 191 KIFTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLS 250 + + ++ L VV ++ ++ F N +V EG GV++ Sbjct: 187 MVLVFVKIIALIVFVVLCLPAFNLAHFT----PFMPNGFQAHVP--EGAAADAAKVGVMA 240 Query: 251 GAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCL 310 A+ F+AF GFD ++T EE KNP++ + +GIV S+ +C Y + AA+++ + Sbjct: 241 AASLIFFAFYGFDAVSTAAEETKNPKRDLTIGIVGSMAVCTAIYM-IVAAVSIGASRTEV 299 Query: 311 DIDSPLPGAFKHQGWEEAKYA--VAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFL 368 S P F + K A VA+ ++ AL T +L M+ R+ + MA DGLL + L Sbjct: 300 FSKSEAPLVFILESLNHGKIAQLVALAAVIALPTVILAFMYGQSRIFFVMARDGLLPRAL 359 Query: 369 AKINNRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRY-QP 427 +K+N +T TPV+ T+ +G +AAV++ L LKD+ +L + GTL A+ V A V++LR +P Sbjct: 360 SKVNAKTGTPVMMTLLTGVLAAVISGLLSLKDIAELANAGTLWAFIAVGASVILLRLREP 419 Query: 428 EQPNL 432 +P + Sbjct: 420 NRPRV 424 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 725 Number of extensions: 43 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 622 Length of database: 483 Length adjustment: 36 Effective length of query: 586 Effective length of database: 447 Effective search space: 261942 Effective search space used: 261942 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory