GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aguB in Caulobacter crescentus NA1000

Align N-carbamoylputrescine amidase; Nitrilase-like protein 1; EC 3.5.1.53 (characterized)
to candidate CCNA_00212 CCNA_00212 N-carbamoylputrescine amidase

Query= SwissProt::Q8VYF5
         (299 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00212 CCNA_00212
           N-carbamoylputrescine amidase
          Length = 292

 Score =  322 bits (825), Expect = 6e-93
 Identities = 152/285 (53%), Positives = 200/285 (70%), Gaps = 1/285 (0%)

Query: 8   REVVVSSLQFACSDDISTNVAAAERLVREAHAKGANIILIQELFEGYYFCQAQREDFFKR 67
           R + V+++Q +   D+  N+   E  +REA +KGA +IL  ELF+G YFC AQ E +F +
Sbjct: 3   RTLSVAAIQTSYGMDLQANIKKTEGFIREAASKGAQVILPSELFQGPYFCVAQEERWFAQ 62

Query: 68  AKPYKNHPTIARMQKLAKELGVVIPVSFFEEANTAHYNSIAIIDADGTDLGIYRKSHIPD 127
           A P++ HP +  +  LA ELGVVIP+S FE     ++NS+ + DADG+ +G+YRKSHIPD
Sbjct: 63  AHPWREHPVVKAIAPLAGELGVVIPISIFEREGPHYFNSLVMADADGSLMGVYRKSHIPD 122

Query: 128 GPGYQEKFYFNPGDTGFKVFQTKFAKIGVAICWDQWFPEAARAMVLQGAEILFYPTAIGS 187
           GPGY EK+YF PGDTGFKV+ T+F +IGV ICWDQW+PE ARAM L GAE LFYPTAIGS
Sbjct: 123 GPGYMEKYYFRPGDTGFKVWDTRFGRIGVGICWDQWYPECARAMALMGAEALFYPTAIGS 182

Query: 188 EPQDQGLDSRDHWRRVMQGHAGANVVPLVASNRIGKEIIETEHGPSQITFYGTSFIAGPT 247
           EP D  LD+   WRR MQGHA +NV+P++ +NRIG E  +      Q TFYG+SF+A   
Sbjct: 183 EPHDASLDTALPWRRAMQGHAVSNVIPVIGANRIGFEPWDGYPNGGQ-TFYGSSFVADHR 241

Query: 248 GEIVAEADDKSEAVLVAQFDLDMIKSKRQSWGVFRDRRPDLYKVL 292
           G++V+E     E ++ A FDLD + + R +WG FRDRRP+LY  L
Sbjct: 242 GDLVSELGRADEGLVSATFDLDFLTTHRAAWGFFRDRRPELYTAL 286


Lambda     K      H
   0.321    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 339
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 299
Length of database: 292
Length adjustment: 26
Effective length of query: 273
Effective length of database: 266
Effective search space:    72618
Effective search space used:    72618
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate CCNA_00212 CCNA_00212 (N-carbamoylputrescine amidase)
to HMM TIGR03381 (aguB: N-carbamoylputrescine amidase (EC 3.5.1.53))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03381.hmm
# target sequence database:        /tmp/gapView.14966.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03381  [M=279]
Accession:   TIGR03381
Description: agmatine_aguB: N-carbamoylputrescine amidase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                             -----------
   7.5e-139  447.8   0.0   8.5e-139  447.6   0.0    1.0  1  lcl|FitnessBrowser__Caulo:CCNA_00212  CCNA_00212 N-carbamoylputrescine


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Caulo:CCNA_00212  CCNA_00212 N-carbamoylputrescine amidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  447.6   0.0  8.5e-139  8.5e-139       2     279 .]       6     286 ..       5     286 .. 0.98

  Alignments for each domain:
  == domain 1  score: 447.6 bits;  conditional E-value: 8.5e-139
                             TIGR03381   2 kvaavqlalsedveeniekaeklvreaaakGaqiillpelfeapyfckeqeeeyfelakpveehplikrlqkl 74 
                                           +vaa+q ++  d+++ni+k e ++reaa+kGaq+il+ elf++pyfc +qee++f++a+p++ehp++k+++ l
  lcl|FitnessBrowser__Caulo:CCNA_00212   6 SVAAIQTSYGMDLQANIKKTEGFIREAASKGAQVILPSELFQGPYFCVAQEERWFAQAHPWREHPVVKAIAPL 78 
                                           79*********************************************************************** PP

                             TIGR03381  75 akelevvlpvsffekagnalynslavidadGevlgvyrkshiPdgpgyeekfyfkpGdtGfkvwdtryakiGv 147
                                           a el+vv+p+s+fe++g +++nsl+++dadG+ +gvyrkshiPdgpgy+ek+yf+pGdtGfkvwdtr+++iGv
  lcl|FitnessBrowser__Caulo:CCNA_00212  79 AGELGVVIPISIFEREGPHYFNSLVMADADGSLMGVYRKSHIPDGPGYMEKYYFRPGDTGFKVWDTRFGRIGV 151
                                           ************************************************************************* PP

                             TIGR03381 148 gicWdqWfpeaaralalkGaevllyPtaiGsePadaeldskehWqramqGhaaanvvpvvaanrigkeveae. 219
                                           gicWdqW+pe+ara+al+Gae l+yPtaiGseP+da+ld++  W+ramqGha++nv+pv+ anrig e  ++ 
  lcl|FitnessBrowser__Caulo:CCNA_00212 152 GICWDQWYPECARAMALMGAEALFYPTAIGSEPHDASLDTALPWRRAMQGHAVSNVIPVIGANRIGFEPWDGy 224
                                           ********************************************************************76655 PP

                             TIGR03381 220 ..leltfyGssfiadetGelvaeadrseeavlvaefdldeiakeraawGlfrdrrpelyekl 279
                                               +tfyGssf+ad++G+lv+e++r +e+++ a+fdld ++++raawG+frdrrpely++l
  lcl|FitnessBrowser__Caulo:CCNA_00212 225 pnGGQTFYGSSFVADHRGDLVSELGRADEGLVSATFDLDFLTTHRAAWGFFRDRRPELYTAL 286
                                           5589*******************************************************875 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (279 nodes)
Target sequences:                          1  (292 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.54
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory