Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate CCNA_00775 CCNA_00775 aspartate aminotransferase
Query= BRENDA::Q9HUI9 (393 letters) >FitnessBrowser__Caulo:CCNA_00775 Length = 385 Score = 159 bits (402), Expect = 1e-43 Identities = 114/360 (31%), Positives = 173/360 (48%), Gaps = 10/360 (2%) Query: 37 LSVGDPDFDTPAPIVQAAIDSLLAGNTHYADVRGKRALRQRIAERHRRRSGQAVDAE-QV 95 L G PD P P+ +AA +L+ G+ Y +RG LR +A + R +D + ++ Sbjct: 29 LGQGFPDDQGPLPVREAAARALIEGSNQYPPMRGLPELRAAVAGHYGRTQDLTLDPDTEI 88 Query: 96 VVLAGAQCALYAVVQCLLNPGDEVIVAEPMYVTYEAVFGACGARVVPVPVR-SENGFRVQ 154 VV +GA AL A L++PGDEV++ +P+Y Y + G VP V+ S +R + Sbjct: 89 VVTSGATEALAAAFTSLISPGDEVVLFQPLYDAYLPLVRRAGG--VPRLVKLSPPHWRFE 146 Query: 155 AEEVAALITPRTRAMALNSPHNPSGASLPRATWEALAELCMAHDLWMISDEVYSELLFDG 214 + A + RTR + LNSP NP+G P LAE+C+ HD+ + DEV+ ++FDG Sbjct: 147 RAMLEAAFSNRTRMVVLNSPLNPAGVVAPDEDLALLAEVCVRHDVVAVCDEVWEAVVFDG 206 Query: 215 EHVSP-ASLPGMADRTATLNSLSKSHAMTGWRVGWVVGPAALCAHLENLALCMLYGSPEF 273 P S PGM +RT + S K MTGW+VG++ L L + + +P Sbjct: 207 RRHRPLMSFPGMRERTVKIGSAGKLFGMTGWKVGFLCAAPPLARALAAAHQFLTFTTPPN 266 Query: 274 IQDAACTALEAPLPELEAMREAYRRRRDLVIECLADSPGLRPLRPDGGMFVMVDIRPTGL 333 +Q L+ + M +R RD + L D+ G L G F+ VD+ +G+ Sbjct: 267 LQAGVAWGLDNHRAWFDDMPANLQRSRDRLTAGLRDA-GYVVLESQGTYFLNVDLAASGI 325 Query: 334 SAQ--AFADRLLDRHGVSVLAGEAF--GPSAAGHIRLGLVLGAEPLREACRRIALCAAEL 389 + F +R + HGV+ + AF +RL L EA RR+A A L Sbjct: 326 ALDDVTFCERCVTEHGVAAIPVSAFFAEDPVTTVVRLCFAKADATLDEAVRRLAAAKAAL 385 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 385 Length adjustment: 30 Effective length of query: 363 Effective length of database: 355 Effective search space: 128865 Effective search space used: 128865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory