Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate CCNA_01603 CCNA_01603 aspartate aminotransferase
Query= BRENDA::Q9HUI9 (393 letters) >FitnessBrowser__Caulo:CCNA_01603 Length = 400 Score = 213 bits (543), Expect = 6e-60 Identities = 135/394 (34%), Positives = 206/394 (52%), Gaps = 18/394 (4%) Query: 8 QRIAGDGAAAWDIHYRALARVEQGEEILLLSVGDPDFDTPAPIVQAAIDSLLAGNTHYAD 67 +RIA A RAL G +++ LS G+PDFDTP I AAI+++ AG T Y D Sbjct: 9 RRIAPSATIAISAKARALKAA--GRDVIALSAGEPDFDTPDNIKNAAIEAIKAGKTKYTD 66 Query: 68 VRGKRALRQRIAERHRRRSGQAVDAEQVVVLAGAQCALYAVVQCLLNPGDEVIVAEPMYV 127 G L+ I + +R +G Q+ V G + +Y + LNPGDEVI+ P +V Sbjct: 67 PDGMPELKAAICAKFKRENGLEYKPSQIHVAPGGKPVIYNALVATLNPGDEVIIPAPYWV 126 Query: 128 TYEAVFGACGARVVPVPVRSENGFRVQAEEVAALITPRTRAMALNSPHNPSGASLPRATW 187 +Y + G V V +E+GF++ E + A ITP+T+ + +NSP NPSG + RA Sbjct: 127 SYPDMTLLAGGTPVSVETTAESGFKITPEALEAAITPKTKWLIINSPSNPSGGAYSRAEL 186 Query: 188 EALAELCMAH-DLWMISDEVYSELLFDG-EHVSPASL-PGMADRTATLNSLSKSHAMTGW 244 +A+A++ + H +W+++D++Y L+FD E + A + P + DRT T+N +SK ++MTGW Sbjct: 187 QAIADVLLRHPQVWVLTDDMYEHLVFDDFEFTTIAQVEPKLYDRTLTMNGVSKGYSMTGW 246 Query: 245 RVGWVVGPAALCAHLENLALCMLYGSPEFIQDAACTALEAPLPELEAMREAYRRRRDLVI 304 R+G+ GP L + + Q AA AL ++ + ++ RRDLV+ Sbjct: 247 RIGYAAGPEPLIKAMGKMISQTTSNPCSISQWAALEALNGTQDFIKPNAKLFQERRDLVV 306 Query: 305 ECLADSPGLRPLRPDGGMFV-------MVDIRPTGL---SAQAFADRLLDRHGVSVLAGE 354 L + GL P+G +V + P+G S + FA LL+ GV+V+ G Sbjct: 307 SMLNQATGLHCPTPEGAFYVYPSCAGLIGKTAPSGKVIESDEDFATELLESEGVAVVHGA 366 Query: 355 AFGPSAAGHIRLGLVLGAEPLREACRRI-ALCAA 387 AFG S R+ E L +AC RI CA+ Sbjct: 367 AFGLSP--FFRISYATSNEVLEDACSRIQRFCAS 398 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 400 Length adjustment: 31 Effective length of query: 362 Effective length of database: 369 Effective search space: 133578 Effective search space used: 133578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory