Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate CCNA_02410 CCNA_02410 alpha-methylacyl-CoA racemase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >FitnessBrowser__Caulo:CCNA_02410 Length = 396 Score = 176 bits (446), Expect = 1e-48 Identities = 129/400 (32%), Positives = 192/400 (48%), Gaps = 16/400 (4%) Query: 4 LSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENTTEA 63 L LRV++L+ +A P A ++AD GADVIKVE P GD R + D G + Sbjct: 2 LEGLRVVELATYIAAPGAAGVMADWGADVIKVESP-EGDPMRRFF-----DTIGSDQDAN 55 Query: 64 AYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKAINP 123 + NR K++V +D G+ ++ L A +DI + N + LA GLDY++LKA+NP Sbjct: 56 PVFELDNRGKRAVVLDIRSDLGREALKALVATADIFLTNVRSAALARAGLDYEALKAVNP 115 Query: 124 QLIYCSITGFGQTGPYAKRAGYDF-MIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDILT 182 +LIYCS++G+G TGP A + G D G+ ++T P+G E P + + D +T Sbjct: 116 RLIYCSLSGYGLTGPDADKPGMDVAAFWSRAGVGAITA-PKGTE---PFPIRTGMGDHVT 171 Query: 183 GLYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHPNI 242 L + +AILAA+ R G G+ ++ +LL V + + L G G + Sbjct: 172 SLATVSAILAAVHERTRTGVGRLVETSLLRTGVYAIGSDMAIQLRFGKLASTRGRREA-V 230 Query: 243 VPYQDF-PTADGDFILTVGNDG--QFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPL 299 P +F T+DG +I + G + + A AG+P+ DDPRFAT K R + L+ + Sbjct: 231 QPLANFYKTSDGRWICLLPRQGSVDWPQIAAAAGRPELVDDPRFATAKARREHGQALVDI 290 Query: 300 IRQATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVA 359 +A T L+ + P ++ D Q +A G ++ P G A Sbjct: 291 FDEAFGSMTYDAAAAALDAGDITWAPYQTPRELALDAQAEAAGCFVDTPDGAGGTFKAPA 350 Query: 360 SPIRLSETPVEYRNAPPLLGEHTLEVLQRVLGLDEAAVMA 399 +P R P R P LG T V R LG E V A Sbjct: 351 APARFPGAPNGPRGPAPKLGADTAAVF-RELGFSEDQVAA 389 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 396 Length adjustment: 31 Effective length of query: 375 Effective length of database: 365 Effective search space: 136875 Effective search space used: 136875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory