GapMind for catabolism of small carbon sources

 

Aligments for a candidate for odc in Caulobacter crescentus NA1000

Align Lysine/ornithine decarboxylase; LDC; EC 4.1.1.17; EC 4.1.1.18 (uncharacterized)
to candidate CCNA_00365 CCNA_00365 ornithine decarboxylase

Query= curated2:O50657
         (393 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00365 CCNA_00365 ornithine
           decarboxylase
          Length = 419

 Score =  162 bits (410), Expect = 2e-44
 Identities = 116/347 (33%), Positives = 178/347 (51%), Gaps = 22/347 (6%)

Query: 43  RAGVFYAMKANPTPEILSLLAGLGSH-FDVASAGEMEILHELGVDGSQMIYANPVKDARG 101
           +  VFYA+KANP+P ++  LA  G   FDVAS  E+E++      GS+M + +PVK    
Sbjct: 40  KGDVFYAVKANPSPWVIRELAKAGVRSFDVASLNEVELVAN-EAPGSRMAFMHPVKSRAA 98

Query: 102 LKAAA-DYNVRRFTFDDPSEIDKMAKAVPGA---DVLVRIAVRNNKALVDLNTKFGAPVE 157
           + AA  D+ V+ F+FD   E+ K+  A   A   +++VR+ V+   A   L+ KFG  + 
Sbjct: 99  ISAAYFDHGVKTFSFDTHEELAKILDATGQAKDLNLIVRMGVQAEGAAYSLSGKFGVEMH 158

Query: 158 EALDLLKAAQDAGLHAMGICFHVGSQSLSTAAYEEALLVARRLFDEAEEMGMHLTDLDIG 217
            A DLL AA+ A    MG+ FHVGSQ +   A++ A+  A R    A   G+    +D+G
Sbjct: 159 NAPDLLLAARRATQDLMGVSFHVGSQCMRPTAFQAAMAQASRALVRA---GVLADVVDVG 215

Query: 218 GGFPVPDAKGLNVDLAAMMEAINKQIDRLF--PDTAVWTEPGRYMCGTAVNLVTSVIGTK 275
           GGFP      +  DL+  + AI++    +     T +W EPGR +   A +L+  V    
Sbjct: 216 GGFPSIYPGMVPPDLSEYLAAIDRGFAEMMVHETTELWCEPGRALVAEASSLLVKV--EL 273

Query: 276 TRGEQPWYILDEGIYGCFSGIMYDHWTYPLHCFGKGNK------KPSTFGGPSCDGIDVL 329
            +G+  +  L++G YG      +  W +P+  + K  +      KP  F GP+CD +D +
Sbjct: 274 KKGDALY--LNDGSYGSLFDAAHMKWPFPVKLYRKSGEVVEEGLKPFRFYGPTCDSVDHM 331

Query: 330 YRDFMAPE-LKIGDKVLVTEMGSYTSVSATRFNGFYLAPTIIFEDQP 375
              F  PE +  GD + +  +G+Y     TRFNGF    T   +D P
Sbjct: 332 PGPFYLPESVDEGDYIEIGMLGAYGVAMNTRFNGFGETDTAQVQDAP 378


Lambda     K      H
   0.320    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 402
Number of extensions: 28
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 393
Length of database: 419
Length adjustment: 31
Effective length of query: 362
Effective length of database: 388
Effective search space:   140456
Effective search space used:   140456
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory