GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patA in Caulobacter crescentus NA1000

Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate CCNA_00620 CCNA_00620 acetylornithine aminotransferase/succinyldiaminopimelate aminotransferase

Query= BRENDA::P42588
         (459 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00620 CCNA_00620 acetylornithine
           aminotransferase/succinyldiaminopimelate
           aminotransferase
          Length = 392

 Score =  211 bits (537), Expect = 3e-59
 Identities = 137/381 (35%), Positives = 204/381 (53%), Gaps = 24/381 (6%)

Query: 76  LVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEL--LDPLRAMLAKTL 133
           L D  G++++D   G  +  +GH +P +V A++ Q A    H+  L  L    A+  K  
Sbjct: 23  LYDQDGRDYLDLAAGVAVNTLGHGDPRLVQALKTQ-ADILWHASNLYRLPAQEALATKLT 81

Query: 134 AALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRGK---FTFIATSGAFHGKSLGALSA 190
            A    ++   FF NSG E+VEAA+K A+ +Q  +G+   +  +    AFHG++L  +SA
Sbjct: 82  DATFADRV---FFANSGAEAVEAAIKTARRWQGAKGRPERYRVLTFGNAFHGRTLATISA 138

Query: 191 TAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPP 250
           T +   R+ F PL   F   PF +IE    A+          AA+++EPIQGEGG+    
Sbjct: 139 TDQMKVREGFTPLYDAFDTTPFNDIEGAARAITP------QTAAILVEPIQGEGGLTPAT 192

Query: 251 PGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIG 310
           PG+L  +R LCD+   L+ILDEVQTG+GRTG +FA E   V+PDI+ +AK LGGG  PIG
Sbjct: 193 PGFLAGLRALCDQHDLLLILDEVQTGIGRTGHLFAHELYGVRPDIIAVAKGLGGG-FPIG 251

Query: 311 ATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGF 370
           A +ATE+  S +   P  H +T+GGNPLACA A A ++ +L         ++  ++    
Sbjct: 252 ACLATEDAASGM--TPGSHGSTYGGNPLACAVASAVLDAVLAPGFLETVRERAALVDALL 309

Query: 371 RQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPP 430
            +L R + DL   A+G G++  ++   +          F    + AG    A  +R+ PP
Sbjct: 310 ERLLRRHSDLFVRAQGHGLMRGLQVRASARDVVAHLRDFGVMTVAAG----ADVVRLLPP 365

Query: 431 LTLTIEQCELVIKAARKALAA 451
             LTI + E+    AR   AA
Sbjct: 366 --LTISELEIAEAEARLLRAA 384


Lambda     K      H
   0.320    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 386
Number of extensions: 17
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 459
Length of database: 392
Length adjustment: 32
Effective length of query: 427
Effective length of database: 360
Effective search space:   153720
Effective search space used:   153720
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory