Align Gamma-glutamyl-gamma-aminobutyrate hydrolase (EC 3.5.1.94) (characterized)
to candidate CCNA_03234 CCNA_03234 glutamine amidotransferase, class I
Query= reanno::MR1:200445 (253 letters) >FitnessBrowser__Caulo:CCNA_03234 Length = 249 Score = 182 bits (463), Expect = 4e-51 Identities = 100/240 (41%), Positives = 132/240 (55%) Query: 6 PLIGVIACNQRLGSHPFNIVGEKYLLGVVNGAKGWPLVIPSLGADQPIEAILARLDGILF 65 P+ G+I C + +G P V +Y+ + L+IPSL + RLDG++ Sbjct: 4 PVAGIICCTRTVGVEPAQAVMSRYVDATMAYGDVAALLIPSLPGRMRAAEVAGRLDGLML 63 Query: 66 TGSPSNVEPHLYAGVPSEAGTHHDPKRDATTLPLIRAAIAAGVPVLGICRGFQEMNVAFG 125 TGSPSN++P LY +A D RD T LI+A + G PV GICRGFQE+NVAFG Sbjct: 64 TGSPSNLDPALYGEEIGDAPGPFDAARDGMTADLIKAMLDLGKPVFGICRGFQEINVAFG 123 Query: 126 GSLHQKLHEVGHFIEHREDKEASLEVQYGPSHSITVEPGGVIYEAWGRNSAEVNSVHTQG 185 G+L + I+H ++ S E + H++ + GGV+ A+G +A VNSVH QG Sbjct: 124 GTLRRDTSSSSDLIDHHAPEDVSFEAMFDHVHAVKLMRGGVLERAFGVQAAVVNSVHYQG 183 Query: 186 VERLGIGLRPEACAPDGLVEAFSVIDATEFALGVQWHPEWKVSDNPFYLSIFNAFGDACR 245 V+RLG GL EA + D LVEAFS L VQWHPEWK + N F FG A R Sbjct: 184 VDRLGEGLSVEALSEDDLVEAFSATVNGAPVLAVQWHPEWKPAQNRQSQIFFEVFGRALR 243 Lambda K H 0.320 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 249 Length adjustment: 24 Effective length of query: 229 Effective length of database: 225 Effective search space: 51525 Effective search space used: 51525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory