GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocD in Caulobacter crescentus NA1000

Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate CCNA_02326 CCNA_02326 acetylornithine aminotransferase/succinyldiaminopimelate aminotransferase

Query= curated2:Q4A0N2
         (394 letters)



>lcl|FitnessBrowser__Caulo:CCNA_02326 CCNA_02326 acetylornithine
           aminotransferase/succinyldiaminopimelate
           aminotransferase
          Length = 405

 Score =  253 bits (646), Expect = 7e-72
 Identities = 144/383 (37%), Positives = 218/383 (56%), Gaps = 8/383 (2%)

Query: 16  YSPLKLALAKGRGAKVWDIEDNCYIDCISGFSVVNQGHCHPKIIKALQEQSQRITMVSRA 75
           Y+   LA  +GRGA++   E   Y+DC++G +    GH HP +++ L+ Q++++  VS  
Sbjct: 18  YNRAPLAFERGRGARLISTEGEEYLDCVAGIATNGLGHAHPALVEVLKAQAEKLWHVSNI 77

Query: 76  LYSDNLGKWEEKICKLANKENVLPMNTGTEAVETAIKMARKWGADIKNIDESSSEIIAMN 135
                  +  + +C  +  + V   N+GTEAVE A+K ARK+ +   N      +I   +
Sbjct: 78  YRIPEQEELADALCANSFADVVFFTNSGTEAVECALKTARKYHS--ANGQPERIDIYGFD 135

Query: 136 GNFHGRTLGSLSLSSQDSYKKGFGPLLNNIHYADFGDIEQLKKLINNQTTA-IILEPIQG 194
           G+FHGRT  +++ S   SY  GFGP L       FGD + +K  I + TTA II+EP+QG
Sbjct: 136 GSFHGRTYAAVNASGNPSYVDGFGPRLPGYSQLTFGDHDAIKAAIASPTTAAIIVEPVQG 195

Query: 195 EGGVNIPPTHFIQEVRQLCNEYNVLLIADEIQVGLGRTGKMFAMEW-ENTEPDIYLLGKS 253
           EGG    PT  +  +RQLC+E+ VLLI DE+Q G+GRTGK+FA EW E  EP I  + K+
Sbjct: 196 EGGARSIPTQCLVGLRQLCDEHGVLLIYDEVQCGMGRTGKLFAYEWAEGGEPHIMAVAKA 255

Query: 254 LGGGLYPISAVLANQDVMSVLTPGTHGSTFGGNPLACAVSMAALDVLNEEHLVQNALDLG 313
           LGGG +PI A LA  +    +T   HGSTFGGNPLA AV  AAL+++     + N   + 
Sbjct: 256 LGGG-FPIGACLATTEAAKGMTVAAHGSTFGGNPLAMAVGKAALEIIKSPETLDNVKTVS 314

Query: 314 DRLLKHLQQIES---ELIVEVRGRGLFIGIELNVAAQDYCEQMINKGVLCKETQGNIIRI 370
               + L  ++    ++IV+VRG+G+ IG++L    +D+     ++ +L      N +R+
Sbjct: 315 GFFTQQLNGLKDRFPDVIVDVRGKGMLIGVKLIPNNRDFMVLARDEKLLIAGGGDNCVRL 374

Query: 371 APPLVIDKDEIDEVIRVITEVLE 393
            PPL +  +E  E I  + +  E
Sbjct: 375 LPPLNLTIEEASEAIAKLEKACE 397


Lambda     K      H
   0.317    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 369
Number of extensions: 23
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 394
Length of database: 405
Length adjustment: 31
Effective length of query: 363
Effective length of database: 374
Effective search space:   135762
Effective search space used:   135762
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory