Align glutaminase (EC 3.5.1.2) (characterized)
to candidate CCNA_00278 CCNA_00278 glutaminase
Query= BRENDA::P0A6W0 (308 letters) >FitnessBrowser__Caulo:CCNA_00278 Length = 306 Score = 260 bits (665), Expect = 2e-74 Identities = 147/299 (49%), Positives = 186/299 (62%), Gaps = 2/299 (0%) Query: 9 ILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQERFSIQSIS 68 +L + VRP G+GK ADYIP LATV G + G+A+ VDG GDA E FS+QSI+ Sbjct: 9 VLAEVAVLVRPHFGKGKPADYIPQLATVPGGKFGMAVRMVDGDEHVIGDADEGFSVQSIT 68 Query: 69 KVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVCDMLQ 128 KV +L +A+ +E IW RVGK+PSG+PFN L LE EQG+PRNPFINAGAL V D+L Sbjct: 69 KVFALGLALNRLGDE-IWTRVGKEPSGTPFNHLSLLEAEQGVPRNPFINAGALAVTDVLM 127 Query: 129 GRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGNFHHDVTTV 188 P + + L G + D VA SE H+ +N AIA LM++ G HD V Sbjct: 128 DVTRDPAALVRDFGGFLCG-ERLEIDPAVATSELAHAWQNRAIASLMRAKGTITHDPEAV 186 Query: 189 LQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMATSGMYQNAG 248 + Y CAL MSC +LAR F+ LA G + E V R++NAL+ T G+Y + G Sbjct: 187 VAAYCRQCALSMSCRQLARAFLPLAAGGFSPIAQETVFPERLTRRLNALLLTCGIYDSVG 246 Query: 249 EFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLTKQLGRSV 307 FA+RVGLPAKSGVGGGIVA+VP + +AVWSPELD G S+ G A LE ++ SV Sbjct: 247 SFAYRVGLPAKSGVGGGIVAVVPGKATVAVWSPELDRFGTSVVGTAALEAFSQITNCSV 305 Lambda K H 0.321 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 306 Length adjustment: 27 Effective length of query: 281 Effective length of database: 279 Effective search space: 78399 Effective search space used: 78399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory