Align beta-aspartyl-peptidase (EC 3.4.19.5); asparaginase (EC 3.5.1.1) (characterized)
to candidate CCNA_00612 CCNA_00612 L-asparaginase
Query= BRENDA::P37595 (321 letters) >FitnessBrowser__Caulo:CCNA_00612 Length = 294 Score = 199 bits (505), Expect = 9e-56 Identities = 128/296 (43%), Positives = 166/296 (56%), Gaps = 22/296 (7%) Query: 5 VIAIHGGAGAISRAQMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLLEECP 64 VIA+HGGAG I R ++ L + L G A+D V AV +E+ Sbjct: 7 VIALHGGAGVIPGRDYG-----RALDHLRDLAARMSSKLADGLDAIDAVEIAVTEMEDSG 61 Query: 65 LFNAGIGAVFTRDETHELDACVMDGNTLKAGAVAGVSHLRNPVLAARLVMEQSPHVMMIG 124 L+ AG G+ E+DA +MDG +AGAV + + +PV AAR V+E +PHV++ G Sbjct: 62 LYVAGRGSAPNAVGVVEMDASIMDGARHRAGAVCAIQGVASPVGAARQVLEATPHVLLAG 121 Query: 125 EGAENFAFARGMERVS--PEIFSTSLRYEQLLAARKEGATVLDHSGAPLDEKQKMGTVGA 182 EGA FA ARG+ + + T + Q A A L H GTVGA Sbjct: 122 EGASQFARARGLPLIGDPANFYRTPVGLTQ--ADIDAEAAALAH-----------GTVGA 168 Query: 183 VALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRALAA 242 VALD G LAAATSTGG+ K PGRVGD+PL GAG +A + VAVSCTG GE FI A Sbjct: 169 VALDRRGALAAATSTGGVFGKRPGRVGDTPLPGAGVWA-DGEVAVSCTGVGEYFILGATA 227 Query: 243 YDIAALMDYGGLSLAEACERVVMEKLPALGGSGGLIAIDHEGNVALPFNTEGMYRA 298 YD+AA + Y G SL +AC+ + ++ LGG GGLIA+D G V+ FN+ G+ RA Sbjct: 228 YDVAARLRYAGQSLDQACQGAI-ARIGELGGDGGLIAVDRRGRVSFQFNSPGLKRA 282 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 294 Length adjustment: 27 Effective length of query: 294 Effective length of database: 267 Effective search space: 78498 Effective search space used: 78498 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory