Align ATPase (characterized, see rationale)
to candidate CCNA_01670 CCNA_01670 sulfate transport ATP-binding protein cysA
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Caulo:CCNA_01670 Length = 339 Score = 146 bits (369), Expect = 5e-40 Identities = 88/233 (37%), Positives = 141/233 (60%), Gaps = 9/233 (3%) Query: 22 IYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWI 81 I VEK +G ++ AL V L + GE++ ++GPSGSGK+T LRT+ LE G++ Sbjct: 3 IAIRSVEKQFG-RYPALNKVDLEIADGELLALLGPSGSGKTTLLRTIAGLEFPDAGQVLF 61 Query: 82 EGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLA-PVQVRRWPVAQAEATAR- 139 +G +++ + + VG VFQQ+ LF H+TV +N+ V+ + ++AE R Sbjct: 62 DGQDVTY----ASAAARRVGFVFQQYALFKHMTVAKNIAFGLDVRKGKDKPSKAEIARRV 117 Query: 140 -QLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLD 198 +LL+ V + +YP QLSGGQ+QRVA++RALA+QP +LL DEP ALD + + + Sbjct: 118 EELLKLVELEGLGGRYPSQLSGGQRQRVALSRALAVQPSVLLLDEPFGALDATVRKSLRR 177 Query: 199 VMRDL-ASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQS 250 +R + + G+T + TH+ A E+ADRV ++ +G+I + PD+ AP++ Sbjct: 178 ELRRVHDATGVTTIFVTHDQEEALELADRVAILNNGRIEQIGTPDQVHDAPET 230 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 339 Length adjustment: 26 Effective length of query: 235 Effective length of database: 313 Effective search space: 73555 Effective search space used: 73555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory