Align BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate CCNA_01507 CCNA_01507 cystine transport system permease protein
Query= TCDB::Q52665 (434 letters) >FitnessBrowser__Caulo:CCNA_01507 Length = 219 Score = 85.9 bits (211), Expect = 1e-21 Identities = 61/207 (29%), Positives = 107/207 (51%), Gaps = 13/207 (6%) Query: 231 LVIGVTAIVVSLPLGILLALGRQSDMLIVKSLSVGIIEFVRGVPLITLLFTASLLLQYFL 290 +V+ V + + + LG LLAL R S +++ + + RG PL+ LF L+ Y L Sbjct: 23 IVLSVIGMSIGVVLGFLLALMRLSRSALLRWPAGVYVSAFRGTPLLVQLF----LIYYGL 78 Query: 291 PP-GTNFDLILRVVILVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWQAQRLIIM 349 P G ++ I +L AAY E++R +AA+ +GQ+EAA LG+ Q R +I+ Sbjct: 79 PQFGLEMPPLVAAGIGFSLNVAAYSCEILRSAIAAVDKGQWEAASVLGMSRGQTLRRVIL 138 Query: 350 PQALKISIPGIVSSFIGLFKDTTLVAFVGLFDPLKGISNVVRSDMAWKGTY--WEPYIFV 407 PQA + ++ + +SFI L KDT+L A + + + + ++ + TY + Y+ Sbjct: 139 PQAARTAVAPLSNSFISLVKDTSLAATIQVPELFR------QAQLITARTYEIFTLYLAA 192 Query: 408 ALIFFLFNFSMSRYSMYLERKLKRDHR 434 A I+++ + ++ LER+ R Sbjct: 193 AAIYWILSTILAAAQTRLERRAAEGRR 219 Lambda K H 0.329 0.143 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 219 Length adjustment: 27 Effective length of query: 407 Effective length of database: 192 Effective search space: 78144 Effective search space used: 78144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory