Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate CCNA_01835 CCNA_01835 ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__Caulo:CCNA_01835 Length = 228 Score = 133 bits (335), Expect = 3e-36 Identities = 84/207 (40%), Positives = 121/207 (58%), Gaps = 7/207 (3%) Query: 12 GTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV---NNLVLNHK 68 G ++L+ ++L V GE++ IIGPSGSGKS+ I GLEE +SG+V + + LN Sbjct: 25 GPVNILRGVDLVVNPGERVAIIGPSGSGKSSLIAVGAGLEEPTSGQVRLFGQDLAKLNED 84 Query: 69 NKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKYLKVVGLLDK 128 + + R A+VFQ F+L P+MT +N+ P+++ ++A TA +L VGL + Sbjct: 85 GRARLRRGRAALVFQSFHLLPNMTAEENVA-TPLEID--GARDAMATARDWLGRVGLSGR 141 Query: 129 ANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMKEISHQSNTT 188 YP LSGG+QQRVA+AR+L + + DEPT LD T V D+M + + Sbjct: 142 LTHYPHQLSGGEQQRVALARALAARPALLFADEPTGNLDGATATSVADLMFNLVTEVGAA 201 Query: 189 MVVVTHEMGFAKEVADRIIFMEDGAIV 215 MV+VTH+ A ADRI+ M DG IV Sbjct: 202 MVMVTHDPVLATR-ADRIVRMADGRIV 227 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 4 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 228 Length adjustment: 23 Effective length of query: 219 Effective length of database: 205 Effective search space: 44895 Effective search space used: 44895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory