Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate CCNA_02173 CCNA_02173 ABC transporter ATP-binding protein
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__Caulo:CCNA_02173 Length = 249 Score = 84.7 bits (208), Expect = 2e-21 Identities = 73/238 (30%), Positives = 122/238 (51%), Gaps = 15/238 (6%) Query: 3 EILLKAENVRAYYKLEKVSVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKP 62 E L+A + +K + ++ + G+ F+ +V V+G SG GK+TL + ++KP Sbjct: 11 ETALEARGLVKRFKTGRSYIEVLKGIDFDAKHGDVTMVMGPSGSGKSTLVAAL-SGLLKP 69 Query: 63 LTLVDGKIFLRVNGEFVELSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHL 122 +GK+ E +L S+ ++ KF I Q L P + ++ V Sbjct: 70 ---DEGKVSAL---EAKDLWSLPTGKID-KFRLDHCGFIFQGFN--LFPALTAKQQVMTA 120 Query: 123 AESHGIDEEELLDKARRRFEEVGLDPLWIKRYPFELSGGMRQRAVIAIATILNPSLLIAD 182 + G E +A+ E VGL P + + P ELSGG +QR IA A NP+L+ AD Sbjct: 121 LKYQGASPGEQARRAQAALESVGLGPR-VNQRPSELSGGEKQRVAIARALAKNPNLIFAD 179 Query: 183 EPTSALDVVNQKVLLKVLMQMKR-QGIVKSIIFITHDIATVRQIADRMIIMYAGKIVE 239 EPTSALD N ++++++L + +G ++I +THD + ADR+I + G+I++ Sbjct: 180 EPTSALDGENGQIVIRLLREAASVRG--AAVICVTHD-PRLEAYADRVIHIEDGRILD 234 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 249 Length adjustment: 26 Effective length of query: 304 Effective length of database: 223 Effective search space: 67792 Effective search space used: 67792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory