Align 6-P-β-galactosidase (Gan1D) (EC 3.2.1.86) (characterized)
to candidate CCNA_02220 CCNA_02220 beta-glucosidase
Query= CAZy::AHL67640.1 (478 letters) >FitnessBrowser__Caulo:CCNA_02220 Length = 482 Score = 271 bits (694), Expect = 3e-77 Identities = 170/472 (36%), Positives = 231/472 (48%), Gaps = 40/472 (8%) Query: 7 KPFPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQE 66 + FP +F+WG A+AA+Q EG+ DG+G S+WDVF + PG G A D Y RYQ+ Sbjct: 39 RQFPKDFVWGVATAAFQTEGSQTADGRGPSIWDVFERVPGHVKNGDTAADATDSYRRYQD 98 Query: 67 DVALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWD 126 DV L+A L AYRFS+SWSR+ P G GAVN GLD Y RL++ L GI P TL+HWD Sbjct: 99 DVDLIAGASLSAYRFSMSWSRILPTGAGAVNAAGLDHYSRLVDALLAKGITPYATLFHWD 158 Query: 127 VPQALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLGLHPP 186 +PQ L D G W +R YA + +R GDR+K ++ LNE + FG+ LG H P Sbjct: 159 LPQGLQDK-GGWANRDTAQRLADYARAVVERLGDRLKNYIILNEAAVHTVFGHVLGDHAP 217 Query: 187 GVKDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPE--NVLAFE 244 G+KD + H NL IQ+ R D +G + A P P N LA + Sbjct: 218 GLKDAALLGPVTHHMNLGQGLAIQALRAARSDLSVGTTMALQPCRPAGGPLAFWNRLASD 277 Query: 245 NAEEFQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKP-DFMGVNYYQT 303 +E N W+D G YP+A + L+ V GD L +P DF+GVNYY Sbjct: 278 GLDEIWNLAWLDPLFKGTYPKAM-----EEPLKGVVRDGD--LKTTRQPVDFLGVNYYAP 330 Query: 304 TTVEHNPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPH-VDTTNWDWAIDPVGLRIG 362 V P P+ + + IDP GL Sbjct: 331 AYVR---------------------LDLSAPSKIAAAAAPNSAEQDAFGRHIDPSGLFEV 369 Query: 363 LRRIANRYQLP-ILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLG 421 L R+ Y P +L+TENG + + P I++D +RI YLRRH++ + A G DV G Sbjct: 370 LDRVRREYGAPKMLVTENGCSDPFSSGPA-ILDDTFRIKYLRRHLEAVLAAREAGCDVRG 428 Query: 422 YCAWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIET 473 Y W+ D W GY ++G + RRI K S+ W++ + +T Sbjct: 429 YFEWTLIDNFEWDLGYTSKFGITTMEAASG-----RRIPKASYGWFKALAQT 475 Lambda K H 0.320 0.139 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 746 Number of extensions: 42 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 478 Length of database: 482 Length adjustment: 34 Effective length of query: 444 Effective length of database: 448 Effective search space: 198912 Effective search space used: 198912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory