Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate CCNA_00294 CCNA_00294 phosphate transport ATP-binding protein pstB
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__Caulo:CCNA_00294 Length = 274 Score = 139 bits (349), Expect = 8e-38 Identities = 98/259 (37%), Positives = 134/259 (51%), Gaps = 23/259 (8%) Query: 3 KLEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQ--PHA--- 57 K++ + + YG + L V L A V + IG SG GKSTFLRCIN + P A Sbjct: 26 KIKARGVKVFYGDKQALFDVDLDIPAKSVTAFIGPSGCGKSTFLRCINRMNDTIPSARVE 85 Query: 58 GKILLNNEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAP-V 116 G IL++ ++ K+ DP L RSR+ MVFQ N + T EN+ P + Sbjct: 86 GSILIDGADVNA--------KSVDPVVL---RSRVGMVFQKPNPFPK-TIFENVAYGPRI 133 Query: 117 HVLGMSKTEAREKAEHYLNKVG----VAHRKDAYPGHMSGGEQQRVAIARALAMEPEVML 172 H L K E E L K G VA R +SGG+QQR+ IARA+A+ PEV+L Sbjct: 134 HGLATGKAELEAIVESSLKKAGLWNEVADRLHQPGTGLSGGQQQRLVIARAIAVSPEVIL 193 Query: 173 FDEPTSALDPELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGN 232 DEP SALDP + +++ L + +V+VTH M A VS + F H G + ESG Sbjct: 194 MDEPCSALDPIATAKIEELIDELRSQ-FCIVIVTHSMAQAARVSQRTAFFHLGKLVESGP 252 Query: 233 PREVLVNPQSERLQQFLSG 251 E+ NP+ R Q +++G Sbjct: 253 TEEMFTNPRDSRTQDYITG 271 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 274 Length adjustment: 25 Effective length of query: 229 Effective length of database: 249 Effective search space: 57021 Effective search space used: 57021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory