Align ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized)
to candidate CCNA_01507 CCNA_01507 cystine transport system permease protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3433 (232 letters) >FitnessBrowser__Caulo:CCNA_01507 Length = 219 Score = 123 bits (308), Expect = 3e-33 Identities = 71/217 (32%), Positives = 117/217 (53%), Gaps = 9/217 (4%) Query: 6 NVIWEALPLYLGGLVTTLKLLALSLFFGLLAALPLGLMRVSKQPVVNMSAWLFTYVIRGT 65 +++ ++ PL L G T+ L + + G++ L LMR+S+ ++ A ++ RGT Sbjct: 6 DLLRQSAPLLLKGAGYTIVLSVIGMSIGVVLGFLLALMRLSRSALLRWPAGVYVSAFRGT 65 Query: 66 PMLVQLFLIYYGLAQFEAVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRATPN 125 P+LVQLFLIYYGL QF + A + F++N +AY+ EI+ ++ A Sbjct: 66 PLLVQLFLIYYGLPQFGLEMPPLV---------AAGIGFSLNVAAYSCEILRSAIAAVDK 116 Query: 126 GEIEAAKAMGMSRIKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGAAR 185 G+ EAA +GMSR + +R++LP A R A+ SN I +++ TSLA+ + + ++ A+ Sbjct: 117 GQWEAASVLGMSRGQTLRRVILPQAARTAVAPLSNSFISLVKDTSLAATIQVPELFRQAQ 176 Query: 186 TVNAQFYLPFEAYITAGVFYLCLTFILVRLFKMAEHR 222 + A+ Y F Y+ A Y L+ IL E R Sbjct: 177 LITARTYEIFTLYLAAAAIYWILSTILAAAQTRLERR 213 Lambda K H 0.330 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 95 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 219 Length adjustment: 22 Effective length of query: 210 Effective length of database: 197 Effective search space: 41370 Effective search space used: 41370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory