Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate CCNA_01508 CCNA_01508 cystine-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3431 (257 letters) >FitnessBrowser__Caulo:CCNA_01508 Length = 261 Score = 120 bits (301), Expect = 3e-32 Identities = 73/229 (31%), Positives = 118/229 (51%), Gaps = 10/229 (4%) Query: 26 LKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEEMKVKCVWVEQEFDGLIPALKVRKID 85 L++G+E YPPF + G + GF+ D AL E++ VK + F GL+ +L+ +ID Sbjct: 41 LRVGLEGTYPPFNFQDKSGQLAGFEVDFAKALAEQLGVKAEFSPAPFAGLLGSLESGRID 100 Query: 86 AILSSMSITEDRKKSVDFTNKYYNTPARLVMKAGTAVSENLAELKGKNIGVQRGSIHERF 145 +++ ++IT DR+ DF+ Y + +++ G L GK +GV G+ +E++ Sbjct: 101 VVINQITITPDRQAKYDFSEPYTVSGIQIIALKGKPAPTGPEGLTGKKVGVGLGTNYEQW 160 Query: 146 AREVLAPLGAEIKPYGSQNEIYLDVAAGRLDGTVADATLLDDGFLKTDAGKGFAFVGPAF 205 R + A+++ Y Y D+ AGR+D + D + D F+KT F G F Sbjct: 161 LRANVPT--ADVRTYDDDPTKYQDLRAGRIDAVLNDRLVAAD-FVKT--SPEFVASGQPF 215 Query: 206 TDVKYFGDGVGIAVRKGDALKDKINTAIAAIRENGKYKQIQDKYFAFDI 254 G G+A++K ALK IN AI A+R NGK I ++F D+ Sbjct: 216 A-----AQGSGVAMQKDPALKVVINQAINALRANGKLAAISQQWFGMDV 259 Lambda K H 0.318 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 261 Length adjustment: 24 Effective length of query: 233 Effective length of database: 237 Effective search space: 55221 Effective search space used: 55221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory