Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate CCNA_01508 CCNA_01508 cystine-binding protein
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__Caulo:CCNA_01508 Length = 261 Score = 114 bits (285), Expect = 2e-30 Identities = 74/230 (32%), Positives = 118/230 (51%), Gaps = 17/230 (7%) Query: 26 EIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKLEVKCTWVHNEFDGMIPALRARKF 85 ++R G+ YPPF G L GF+++ A+ +L VK + F G++ +L + + Sbjct: 40 KLRVGLEGTYPPFNFQDKSGQLAGFEVDFAKALAEQLGVKAEFSPAPFAGLLGSLESGRI 99 Query: 86 DAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSADFGDTPESLMGKQVGVLQGSLQEA 145 D +++ + +TP R+ DFS+ +S +I K PE L GK+VGV G+ E Sbjct: 100 DVVINQITITPDRQAKYDFSEPYTVSGIQIIALKGKPAPTGPEGLTGKKVGVGLGTNYEQ 159 Query: 146 YARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTDKLEAQLNFLSKPEGSDF-KTGPA 204 + RA++ A ++ Y Y DL+ GR+DA L D+L A +DF KT P Sbjct: 160 WLRANVPT--ADVRTYDDDPTKYQDLRAGRIDAVLNDRLVA----------ADFVKTSPE 207 Query: 205 FKDPTLPLDIAMG---LRKNDQALRALINKGIAAVQADGTYAQIQKKYFG 251 F P A G + D AL+ +IN+ I A++A+G A I +++FG Sbjct: 208 FVASGQPF-AAQGSGVAMQKDPALKVVINQAINALRANGKLAAISQQWFG 256 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory