GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astC in Caulobacter crescentus NA1000

Align Succinylornithine transaminase; SOAT; Succinylornithine aminotransferase; EC 2.6.1.81 (characterized)
to candidate CCNA_00620 CCNA_00620 acetylornithine aminotransferase/succinyldiaminopimelate aminotransferase

Query= SwissProt::Q8ZPV2
         (408 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00620 CCNA_00620 acetylornithine
           aminotransferase/succinyldiaminopimelate
           aminotransferase
          Length = 392

 Score =  338 bits (868), Expect = 1e-97
 Identities = 189/388 (48%), Positives = 235/388 (60%), Gaps = 9/388 (2%)

Query: 14  MVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRFWH 73
           ++  Y  A    VRGEG  L+DQ G++Y+D A G+AVN LGH  P L +AL  QA+  WH
Sbjct: 4   LMNTYARANIDIVRGEGCWLYDQDGRDYLDLAAGVAVNTLGHGDPRLVQALKTQADILWH 63

Query: 74  IGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGIVA 133
             N Y       LA KL DATFA+RVFF NSGAEA EAA+K AR++   +    +  ++ 
Sbjct: 64  ASNLYRLPAQEALATKLTDATFADRVFFANSGAEAVEAAIKTARRWQGAKGRPERYRVLT 123

Query: 134 FKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDNTCAVIVEPVQ 193
           F NAFHGRTL T+SA  Q    + F PL        +ND+  A+  I   T A++VEP+Q
Sbjct: 124 FGNAFHGRTLATISATDQMKVREGFTPLYDAFDTTPFNDIEGAARAITPQTAAILVEPIQ 183

Query: 194 GEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHYGVTPDILTTAKA 253
           GEGG+ PAT  FL GLR LCD+H  LLI DEVQTG+GRTG L+A+  YGV PDI+  AK 
Sbjct: 184 GEGGLTPATPGFLAGLRALCDQHDLLLILDEVQTGIGRTGHLFAHELYGVRPDIIAVAKG 243

Query: 254 LGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIINTPEMQNGVRQRH- 312
           LGGGFPIGA L T+D AS MTPG+HG+TYGGNPLA AVA  VLD +  P     VR+R  
Sbjct: 244 LGGGFPIGACLATEDAASGMTPGSHGSTYGGNPLACAVASAVLDAVLAPGFLETVRERAA 303

Query: 313 --DAFIERLNTLNVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAKAGVMVLIAGG 370
             DA +ERL  L     +F   +G GL+ G     +    A+ +       GVM + AG 
Sbjct: 304 LVDALLERL--LRRHSDLFVRAQGHGLMRG----LQVRASARDVVAHLRDFGVMTVAAGA 357

Query: 371 DVVRFAPALNVSDEEIATGLDRFALACE 398
           DVVR  P L +S+ EIA    R   A E
Sbjct: 358 DVVRLLPPLTISELEIAEAEARLLRAAE 385


Lambda     K      H
   0.320    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 455
Number of extensions: 16
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 408
Length of database: 392
Length adjustment: 31
Effective length of query: 377
Effective length of database: 361
Effective search space:   136097
Effective search space used:   136097
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory