Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate CCNA_02326 CCNA_02326 acetylornithine aminotransferase/succinyldiaminopimelate aminotransferase
Query= BRENDA::O30508 (406 letters) >FitnessBrowser__Caulo:CCNA_02326 Length = 405 Score = 308 bits (789), Expect = 2e-88 Identities = 171/385 (44%), Positives = 228/385 (59%), Gaps = 9/385 (2%) Query: 18 VPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHV 77 V N AP AF RG G+R+ G E +D GIA LGHAHPALV+ L QA+++WHV Sbjct: 17 VYNRAPLAF--ERGRGARLISTEGEEYLDCVAGIATNGLGHAHPALVEVLKAQAEKLWHV 74 Query: 78 SNVFTNEPALRLARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYEIIAA 137 SN++ LA L +FA+ VF NSG EA E A K AR+Y + P++ +I Sbjct: 75 SNIYRIPEQEELADALCANSFADVVFFTNSGTEAVECALKTARKYHSANGQPERIDIYGF 134 Query: 138 SNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAI-SDKTCAVVLEPIQ 196 SFHGRT VN G P Y DGFGP+ G + + + D +A+KAAI S T A+++EP+Q Sbjct: 135 DGSFHGRTYAAVNASGNPSYVDGFGPRLPGYSQLTFGDHDAIKAAIASPTTAAIIVEPVQ 194 Query: 197 GEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAY-MHYGVVPDILSSAK 255 GEGG L G R+LCDEH LL++DEVQ GMGR G+LFAY G P I++ AK Sbjct: 195 GEGGARSIPTQCLVGLRQLCDEHGVLLIYDEVQCGMGRTGKLFAYEWAEGGEPHIMAVAK 254 Query: 256 SLGGGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKH 315 +LGGGFPIGA L T E AK ++V HG+T+GGNPLA AV +AAL++I +PE LD VK Sbjct: 255 ALGGGFPIGACLATTEAAKGMTVAAHGSTFGGNPLAMAVGKAALEIIKSPETLDNVKTVS 314 Query: 316 ERFKSRLQKIGQEY-GIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQASPD 374 F +L + + + ++RG G+LIG L RD + A E +++ + Sbjct: 315 GFFTQQLNGLKDRFPDVIVDVRGKGMLIGVKLIP----NNRDFMVLARDEKLLIAGGGDN 370 Query: 375 VVRFAPSLVIDDAEIDEGLERFERA 399 VR P L + E E + + E+A Sbjct: 371 CVRLLPPLNLTIEEASEAIAKLEKA 395 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 405 Length adjustment: 31 Effective length of query: 375 Effective length of database: 374 Effective search space: 140250 Effective search space used: 140250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory