GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ech in Caulobacter crescentus NA1000

Align 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35); short-chain-enoyl-CoA hydratase (EC 4.2.1.150) (characterized)
to candidate CCNA_03293 CCNA_03293 multifunctional fatty acid oxidation complex subunit alpha FadJ

Query= BRENDA::A4YDS4
         (651 letters)



>lcl|FitnessBrowser__Caulo:CCNA_03293 CCNA_03293 multifunctional
           fatty acid oxidation complex subunit alpha FadJ
          Length = 696

 Score =  166 bits (419), Expect = 4e-45
 Identities = 126/398 (31%), Positives = 204/398 (51%), Gaps = 34/398 (8%)

Query: 2   KVTVIGSGVMGHGIAELAAIAGNEVWMNDISTEILQQAMERIKWSLSKLRESGSL-KEGV 60
           KV VIG+G MG GIA     AG  V + +   E L++ +  I+ +     + G L ++ V
Sbjct: 306 KVGVIGAGTMGGGIAMNFLNAGIPVTIIEAKQENLERGVGIIRKNYENTAKKGRLTQDDV 365

Query: 61  EQVLARIHPETDQAQALKGSDFVIEAVKEDLELKRTIFRNAEAHASPSAVLATNTSSLPI 120
           E+ +A + P  +  +AL   D +IEAV E +E+K+ +F   +  A P A+LATNTS L +
Sbjct: 366 EKRMALLTPSMEM-EALADCDMIIEAVFELMEIKKEVFTKLDKIAKPGAILATNTSYLDV 424

Query: 121 SEIASVLKSPQRVVGMHFFNPPVLMPLVEIVRGKDTSDEVVKTTAEMAKSMNKETIVVKD 180
             IA+V   P+ V+G HFF+P  +M L+E+VRG  TS +V+ T  +++K++ K  ++V  
Sbjct: 425 DAIAAVTSRPESVIGTHFFSPANVMRLLELVRGDKTSKDVIATCMKLSKTIGKVPVLVGV 484

Query: 181 VPGFFVNRVLLRIMEAGCYLVEKGIASIQEVDSSAIEELGFPMGVFLLADYTGLDIGYSV 240
             GF  NR+L +       L+ +G A   +VD   + + G PMG F ++D  GLDIG+  
Sbjct: 485 CYGFVGNRMLAQRQREAQKLILEG-AMPWDVD-RVLYDFGLPMGPFAMSDLAGLDIGWDP 542

Query: 241 WKAVTARGFKAFPCSSTEKLVSQGKLGVKSGSGYYQY-------PSP--GKFVRPTLPS- 290
            K  ++        +  E L    + G K+G G+Y Y       PSP   + +R      
Sbjct: 543 AKTSSS--------TVREVLCEMDRRGQKNGKGFYDYDENRNAKPSPVVEEVIRDFAEKR 594

Query: 291 -------TSKKLGRYLISPAVNEVSYLLREG-IVGKDDAEKGCVLGLGLP---KGILSYA 339
                  T +++    + P VNE + +L EG  +   D +   + G G P    G + + 
Sbjct: 595 QIQRREITDQEILERCLYPMVNEGAKILEEGKAIRASDIDIVWINGYGWPVYSGGPMFWG 654

Query: 340 DEIGIDVVVNTLEEMRQTSGMDHYSPDPLLLSMVKEGK 377
           + +G+D V+  +++     G D + P  LL  +V EGK
Sbjct: 655 ELVGLDKVLAKMKQFHAELG-DDFKPSALLERLVAEGK 691



 Score =  127 bits (318), Expect = 2e-33
 Identities = 81/196 (41%), Positives = 114/196 (58%), Gaps = 9/196 (4%)

Query: 403 VEPPLAWIVLNRPTRYNAINGDMIREINQALDSLEEREDVRVIAITGQGRVFSAGADVTE 462
           VE  +  + LN P   NA++  +   +  A D+      V+ I +   G+ F AGAD+TE
Sbjct: 16  VEGDIGVVTLNSPP-VNALSAAVREGLQGAFDAAIADAAVKAIVLICDGKTFIAGADITE 74

Query: 463 FGSLTPVKAMIASRKFHEVFMKIQFLTKPVIAVINGLALGGGMELALSADFRVASKTAEM 522
           FG     KAM       +V   I+   KPVIA I+G ALGGG+E+AL A++RVA  +A+ 
Sbjct: 75  FG-----KAMTGP-SLQDVQNVIENSPKPVIAAIHGTALGGGLEVALVANYRVAVPSAKA 128

Query: 523 GQPEINLGLIPGGGGTQRLSRLSG-RKGLELVLTGRRVKAEEAYRLGIVEFLAEPEELES 581
           G PE+N+GL+PG GGTQRL R+ G  K LE+V TG+ V A+ A+ +G+ + L E  +L  
Sbjct: 129 GLPEVNIGLLPGAGGTQRLPRIVGVEKALEMVTTGQHVPAKAAHAMGLFDELVEEGKLRE 188

Query: 582 EVRKLANA-IAEKSPL 596
                A A +AE  PL
Sbjct: 189 GAIAFAKAVVAENRPL 204


Lambda     K      H
   0.316    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 958
Number of extensions: 36
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 651
Length of database: 696
Length adjustment: 39
Effective length of query: 612
Effective length of database: 657
Effective search space:   402084
Effective search space used:   402084
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory