GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocA in Caulobacter crescentus NA1000

Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate CCNA_03243 CCNA_03243 NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase

Query= BRENDA::Q65NN2
         (516 letters)



>lcl|FitnessBrowser__Caulo:CCNA_03243 CCNA_03243 NADP+-dependent
           gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
          Length = 499

 Score =  242 bits (617), Expect = 3e-68
 Identities = 159/460 (34%), Positives = 236/460 (51%), Gaps = 16/460 (3%)

Query: 41  VIDGERYETENKIVSINPANKE-EVVGTVSKATQDHAEKAIQAAAKAFET--WRYTDPEE 97
           VIDG+  E  +     N + ++ +V+  V+    D  E+A+  A  AFE   WR   P +
Sbjct: 24  VIDGDLVEAASGATFHNVSPRDGQVLNLVTACQADDVERAVAGARAAFEDGRWRDQGPRQ 83

Query: 98  RAAVLFRAVAKVRRKKHEFSALLVKEAGKPWNEA-DADTAEAIDFMEYYARQMIELAKGK 156
           + AVLFR    + R   E + L   + GKP ++A + D   AI+   +YA + ++   G+
Sbjct: 84  KKAVLFRLAELMERDADELALLESLDVGKPISDARNVDIPLAINTCRWYA-EALDKVYGE 142

Query: 157 PVNSREGERNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASAAPVIAA 216
              S     +  V+ P GV   I PWNF   +        +  GN+VVLKPA  +P+ A 
Sbjct: 143 VGTSPADRLSYAVHEPLGVIGAIVPWNFPLHMAMWKVAPALAMGNSVVLKPAEQSPLTAL 202

Query: 217 KFVEVLEESGLPKGVVNFVPGSGAEVGDYLVDHPKTSIITFTGSREVGTRIFERAAKVQP 276
           K   +  E+GLP GV+N +PG G   G+ L       +I FTGS  VG R+ E +A+   
Sbjct: 203 KLGALALEAGLPPGVLNVIPGLGGVAGEALALSMDVDMIAFTGSGPVGRRLMEYSAR--- 259

Query: 277 GQTHLKQVIAEMGGKDTVVVDEDC-DIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYD 335
             ++LK+V  E+GGK   +V  DC D+E AAQ+     F   G+ C+A SR +V   + D
Sbjct: 260 --SNLKRVSLELGGKSPQIVFADCPDLEAAAQAAAWGVFYNQGEVCTAASRLLVEAPIKD 317

Query: 336 EVLKRVIEITESKKVGEPDSADVYMGPVIDQASFNKIMDYIEIGKEEG-RLVSGGK--GD 392
             L RVIE+ +  KVG+P       G ++ +   N  +DYI     +G R V GG+    
Sbjct: 318 AFLARVIEVAKGMKVGDPLDPSTQFGAMVSERQMNTALDYIATADSQGARRVLGGQRVRQ 377

Query: 393 DSKGYFIEPTIFADLDPKARLMQEEIFGPVVAFSKVSSFDEALEVANNTEYGLTGAVITK 452
           ++ G+++EPTIF  + P   L +EE+FGPV+     SS DEA+ +AN+T YGL   + T 
Sbjct: 378 EAGGFYVEPTIFDQVRPDQTLAREEVFGPVLGVMTFSSEDEAMRLANDTVYGLAAGLWTA 437

Query: 453 NRDHINRAKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSG 492
           +     R  +    G ++ N      I    PFGGFK SG
Sbjct: 438 DVSKALRGARRLKAGLVWVNGWDACDIT--MPFGGFKQSG 475


Lambda     K      H
   0.315    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 563
Number of extensions: 24
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 516
Length of database: 499
Length adjustment: 34
Effective length of query: 482
Effective length of database: 465
Effective search space:   224130
Effective search space used:   224130
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory