GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Caulobacter crescentus NA1000

Align aldehyde dehydrogenase [NAD(P)+] (EC 1.2.1.5) (characterized)
to candidate CCNA_01274 CCNA_01274 piperideine-6-carboxylate dehydrogenase

Query= BRENDA::Q69P84
         (509 letters)



>lcl|FitnessBrowser__Caulo:CCNA_01274 CCNA_01274
           piperideine-6-carboxylate dehydrogenase
          Length = 507

 Score =  450 bits (1157), Expect = e-131
 Identities = 229/471 (48%), Positives = 306/471 (64%), Gaps = 4/471 (0%)

Query: 42  PTNNQVIAEVVEASAREYEEGMRACYDAAKTWMAIPAPKRGEIVRQIGDALRAKLHHLGR 101
           P +  ++  VV   AR+ E  + A   A   W  +PAP+RGE+VR  G+ LRA    L  
Sbjct: 35  PIDGAILGHVVYDDARQIEAKVAAACRAFADWRVVPAPRRGELVRLFGEELRAAKADLAA 94

Query: 102 LVSLEMGKILPEGIGEVQEIIDMCDYAVGLSRQLNGSIIPSERPNHMMMEVWNPLGVVGV 161
           LV+LE GKI  E  GEVQE+ID+CD+AVGLSRQL+G  I SERP H M E W+PLG V V
Sbjct: 95  LVTLEAGKIASEAAGEVQEMIDICDFAVGLSRQLHGLTIASERPGHAMRETWHPLGPVAV 154

Query: 162 ITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKIVASVLER-NNLPGSIFT 220
           I+AFNFP AV  WNAC+ALVCG+ V+WK +  TPL  +A   I+   L R  + P  + +
Sbjct: 155 ISAFNFPVAVWAWNACLALVCGDPVIWKPSEKTPLTALATQAILERALARFRDAPQGLSS 214

Query: 221 AFCGGADIGQAISLDTRIPLVSFTGSTKVGLMVQQQVNARFGKCLLELSGNNAIIVMDDA 280
              G  D G+ ++ D RIPLVS TGST++G  V   V  RFG+ +LEL GNNA+IV   A
Sbjct: 215 VVLGARDAGERLARDPRIPLVSATGSTRMGRAVAPMVAERFGRSILELGGNNAMIVTPSA 274

Query: 281 DIQLAVRSVLFAAVGTAGQRCTTCRRLLLHESIYRTFLDQLVEVYKQVRIGDPLENGTLL 340
           D+ LA+R+++F+A GTAGQRCT+ RRL++HES+     D +   ++++ +GDP +  TLL
Sbjct: 275 DLSLALRAIVFSAAGTAGQRCTSLRRLIVHESLVDKVSDAVEAAFQRLSVGDPRDPKTLL 334

Query: 341 GPLHTPASRDAFLKGIQTIRSQGGKILYGGSAIESE---GNFVQPTIVEISPSAPVVREE 397
           GPL   A+ DAF+  +  +R++GG +  G   +  E     +V+P +  +   AP ++ E
Sbjct: 335 GPLIDKAAYDAFIAAMNQVRAEGGSVAGGERVLIDEHPDAYYVRPALARLPAPAPCMQRE 394

Query: 398 LFGPVLYVMKVQNLKEAVEINNSVPQGLSSSIFTKRPDIIFKWIGPHGSDCGIVNVNIPT 457
            F P+L+V+   +   A+ I N VPQGLSS + T       +++   GSDCGI NVNI  
Sbjct: 395 TFAPLLHVVPYNSFDMAIAIQNDVPQGLSSCVMTNDVREAERFLAAAGSDCGIANVNIGP 454

Query: 458 NGAEIGGAFGGEKATGGGREAGSDSWKQYMRRATCTINYGSELPLAQGINF 508
           +GAEIGGAFGGEK TGGGRE+GSDSWKQYMRR T T+NY   LPLAQG+ F
Sbjct: 455 SGAEIGGAFGGEKETGGGRESGSDSWKQYMRRQTATVNYSGALPLAQGVRF 505


Lambda     K      H
   0.320    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 674
Number of extensions: 25
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 509
Length of database: 507
Length adjustment: 34
Effective length of query: 475
Effective length of database: 473
Effective search space:   224675
Effective search space used:   224675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory