Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate CCNA_03172 CCNA_03172 3-oxoacyl-(acyl-carrier protein) reductase
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >FitnessBrowser__Caulo:CCNA_03172 Length = 254 Score = 105 bits (261), Expect = 1e-27 Identities = 79/264 (29%), Positives = 126/264 (47%), Gaps = 20/264 (7%) Query: 1 MSIIDLLKPRPGLRVFVSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKLH 60 MS+ DL G ++ + GIG AIAE E A+V I +E S H Sbjct: 1 MSLFDLT----GKVAIITGSSRGIGKAIAERMAEHGAKVVISSRKAGPCEEVASELNAKH 56 Query: 61 ------AGIADVSKQAQVDQIIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTV 114 A A+++ + ++ ++D+ R+ G +D+ V NA G + + Q+ + Sbjct: 57 GAGTAIAVPANIASKDELQNLVDETRKAFGKIDICVCNAASNPYYGPLAGIADDQFRKIL 116 Query: 115 STNLNSQFYFLRKAVPVLKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLA 174 N+ S + + P ++ D SII +SS+ G G Y +K A L ++LA Sbjct: 117 DNNIISNHWLIGMVAPEMQARKD-GSIIIISSIGGLRGNAIIGAYNISKAADFQLARNLA 175 Query: 175 AELGPSNVRVNAILPGVVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDI 234 E GP NVRVN I PG+++ + + + + L + + LRR+ D+I Sbjct: 176 HEFGPDNVRVNCIAPGLIKTD-FAKALWDNPETL--------KRSTTAVPLRRIGEPDEI 226 Query: 235 AAMALFLASPAGSNVTGQAISVDG 258 A A++LAS AGS +TGQA+ VDG Sbjct: 227 AGAAVYLASKAGSFMTGQAMVVDG 250 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 254 Length adjustment: 24 Effective length of query: 239 Effective length of database: 230 Effective search space: 54970 Effective search space used: 54970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory