GapMind for catabolism of small carbon sources

 

Aligments for a candidate for etoh-dh-nad in Caulobacter crescentus NA1000

Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate CCNA_02725 CCNA_02725 choline dehydrogenase

Query= BRENDA::Q76HN6
         (526 letters)



>lcl|FitnessBrowser__Caulo:CCNA_02725 CCNA_02725 choline
           dehydrogenase
          Length = 555

 Score =  462 bits (1188), Expect = e-134
 Identities = 252/530 (47%), Positives = 335/530 (63%), Gaps = 12/530 (2%)

Query: 3   FDYLIVGAGSAGCVLANRLSADPSVTVCLLEAGPEDRSPLIHTPLGLAAILPTR-HVNWA 61
           FDY+++GAGSAGCVLA RL+ DP++ V LLEAG +++S L+  P G+  ++  +   NW 
Sbjct: 6   FDYIVIGAGSAGCVLAARLTEDPNIKVLLLEAGGKNKSILVKMPAGVGQLIKDKGEQNWG 65

Query: 62  FKTTPQPGLGGRVGYQPRGKVLGGSSSINGMIYIRGHQDDFNDWQALGNEGWGFDDVLPY 121
           F T  +P L  R  + PRGK LGGSS+INGMIYIRGH  D++ W+ +G  GW + +VLPY
Sbjct: 66  FWTEAEPHLDNRKLWWPRGKGLGGSSAINGMIYIRGHARDYDQWRQMGLTGWSYSEVLPY 125

Query: 122 FRKSEMHHGGSSEYHGGDGELYVSPANRHAA-SEAFVESALRAGHSYNPDFNGATQEGAG 180
           F++SE HH G   YHGG G L+VS     +      VE+  +AGH    DFNG  QEG G
Sbjct: 126 FKRSETHHAGGDAYHGGSGPLHVSKGESDSPFYSTLVEAGRQAGHKTTKDFNGYQQEGFG 185

Query: 181 YYDVTIRDGRRWSTATAFLKPVRHRSNLTVLTHTHVESIVLLGKQATGVQALIKGSRVH- 239
            YD+TIRDG+RWS A A+L     R NLT +T      I+L  ++A GV+ ++  SR   
Sbjct: 186 PYDLTIRDGQRWSAAMAYLNQALSRPNLTCVTEACTTRIILDKRRAVGVEYVVGKSREKQ 245

Query: 240 -LRARKEVILSAGAFGSPHLLMLSGIGSAAELEPQGIAPRHELPGVGQNLQDHADVVLCY 298
              A  EV+LSAGA  SP +L LSGIG+A +L P GIA  HE  GVG NLQDH DV + +
Sbjct: 246 VAYADAEVLLSAGAVQSPQILQLSGIGAAEDLAPHGIAVAHESKGVGANLQDHLDVCVSW 305

Query: 299 KSNDTSLLGFSLSGGVKMGKAMFDYARHRNGPVASNCAEAGAFLKTDPGLERPDIQLHSV 358
            + +      +  G  K+G  M +Y     G       E+GAFLK+ P L+RPD+Q+H V
Sbjct: 306 TAKNLKTAYSANKGLNKLGVGM-NYMFFGKGLGRQQFLESGAFLKSRPDLDRPDLQIHGV 364

Query: 359 IGTVDDHNRKLHWGHGFSCHVCVLRPKSIGSVGLASPDPRKAPRIDPNFLAHDDDVATLL 418
           +  + DH + +    GF+ HVC LRP+S G VGL S DP   P I  N+LA ++D   + 
Sbjct: 365 LAIMQDHGKVVVEKDGFTLHVCQLRPESRGKVGLRSADPFDDPTILGNYLATEEDRRAIR 424

Query: 419 KGYRITRDIIAQTPMASFGLRDM-YSAG--LHNDEQLIELLRKRTDTIYHPIGTCKMG-- 473
           +G RI R+ +AQ     +  RD  Y+ G  + +D  L   +R + +TIYHP+GTC+MG  
Sbjct: 425 EGVRIARETVAQAAFDPY--RDAEYAPGADVKSDADLDAWIRSKAETIYHPVGTCRMGVA 482

Query: 474 QDEMAVVDSQLRVHGIEGLRVVDASIMPTLVGGNTNAAAIMIAERAAEWI 523
            D MAVVD QLRV G++GLRV+DAS+MPTL+GGNTNA  IMIAERAA+ I
Sbjct: 483 GDPMAVVDDQLRVQGVQGLRVIDASVMPTLIGGNTNAPTIMIAERAADLI 532


Lambda     K      H
   0.319    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 868
Number of extensions: 40
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 526
Length of database: 555
Length adjustment: 35
Effective length of query: 491
Effective length of database: 520
Effective search space:   255320
Effective search space used:   255320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory