Align alcohol dehydrogenase (EC 1.1.1.1); all-trans-retinol dehydrogenase (NAD+) (EC 1.1.1.105) (characterized)
to candidate CCNA_03124 CCNA_03124 NAD/mycothiol-dependent formaldehyde dehydrogenase
Query= BRENDA::C7R702 (374 letters) >FitnessBrowser__Caulo:CCNA_03124 Length = 366 Score = 248 bits (634), Expect = 1e-70 Identities = 143/366 (39%), Positives = 206/366 (56%), Gaps = 6/366 (1%) Query: 9 KAAVAWEAGKPLSIEEVEVQPPQKGEVRVKIVATGVCHTDAFTLSGDDPEGVFPSILGHE 68 KAAV E GKPL IE V + P EV ++ A GVCH+D + G + P++LGHE Sbjct: 2 KAAVLREVGKPLQIETVAIGKPGPREVLIRTKAAGVCHSDLHFVEGSYTHAL-PAVLGHE 60 Query: 69 GGGIVESVGEGVTSVKPGDHVIPLYTPECGDCKFCLSGKTNLCQKIRETQGKGLMPDGTT 128 GIVE+VG V +VK GDHVI P CG C+ CL+G NLC + K P Sbjct: 61 SAGIVEAVGSEVRTVKVGDHVITCLNPYCGHCEVCLTGHMNLCISPETRRSKSDAPR-LF 119 Query: 129 RFSINGK--PIYHYMGTSTFSEYTVLPEISLAKVNPKAPLEEVCLLGCGVTTGMGAVMNT 186 + +NG P+ ++ S+F+E ++ E + + P + L+GC V TG+GAVM+T Sbjct: 120 KEDLNGATGPMAQFLNLSSFAEMMLVHEHACVAIRKDMPFDRAALIGCSVMTGVGAVMHT 179 Query: 187 AKVEEGATVAIFGLGGIGLSAVIGAVMAKASRIIAIDINESKFELAKKLGATDCVNPKDY 246 + V G TVA+ G GG+GL+ + GA +A A RIIAID K ELAK GATD V+ Sbjct: 180 SNVRPGETVAVIGCGGVGLATINGAAIAGAGRIIAIDRLAGKLELAKTFGATDVVDASQV 239 Query: 247 DKPIQEVIVEMTDGGVDYSFECIGNVNVMRSALECCHKGWGESVIIGVAGAGQEISTRPF 306 D I + +VE+T GGV +SFE IG ++ + +G G + +IG+ G +I Sbjct: 240 D-DIAKAVVELTGGGVHHSFEAIGLKATAEASFKMLRRG-GTANVIGMIPVGTKIELHGV 297 Query: 307 QLVTGRVWKGTAFGGVKGRSELPDYVERYLAGEFKLDDFITHTMPLEKINDAFDLMHEGK 366 + R +G+ G + ++P V+ Y++G+ KLD+ I+ + LE +N AFD + G+ Sbjct: 298 DFLGERRIQGSYMGSNRFPVDMPRLVDFYMSGKLKLDELISRRIKLEDVNSAFDELKRGE 357 Query: 367 SIRSVI 372 RSVI Sbjct: 358 LARSVI 363 Lambda K H 0.317 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 366 Length adjustment: 30 Effective length of query: 344 Effective length of database: 336 Effective search space: 115584 Effective search space used: 115584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory