Align 1-phosphofructokinase; EC 2.7.1.56; Fructose 1-phosphate kinase (uncharacterized)
to candidate CCNA_01001 CCNA_01001 ribokinase
Query= curated2:P23386 (316 letters) >FitnessBrowser__Caulo:CCNA_01001 Length = 303 Score = 67.8 bits (164), Expect = 3e-16 Identities = 86/272 (31%), Positives = 111/272 (40%), Gaps = 30/272 (11%) Query: 39 GGKGVNVASFLAHVGHGVAVTGLLGAEN--AALFARHFAATGLVDACQRLPGAT--RTNV 94 GGKG N A A +G + G +G ++ A L A+ V LPG + +V Sbjct: 37 GGKGANQAVAAARMGVATRLMGAVGGDDSGAGLKAKLAGYGVQVGDVVELPGVPTGQAHV 96 Query: 95 KIVDPLQDQVTDLNFPGIAAGPADLDAVAATLTELLAQGLDWVALCG-SLPAGIGAEAYA 153 + + ++ + P VAAT E V LC PA Sbjct: 97 WVANSAENMIVVTAGANAMVTPQQ---VAATTIEGQR-----VLLCQLETPA-------T 141 Query: 154 ELAALARKGGARVALD--TSGPAL--GLALAARPDIVKPNVAELG--AHLGRTLTGLESV 207 + L R G A+ AL + PAL G AL DI+ N EL A L R LE V Sbjct: 142 AIETLFRAGSAKGALRILNAAPALPQGAALFPLTDILIVNQTELATYAKLDREPVKLEEV 201 Query: 208 REAARDLAASGVGLVAVSMGAGGAVLVRGAEAVLAIPPATPIASTVGAGDAMVAGLIHAA 267 AAR L + + V++GA GA +VR EA L TVGAGD L Sbjct: 202 SVAARKLMSRPDQTIIVTLGAAGAAVVRRDEAFLVEGKKVKAVDTVGAGDCFCGALAATL 261 Query: 268 TLGLDLA---ETARLATAFSLGALGEIGPHLP 296 G+DLA ETA A A S+ G P +P Sbjct: 262 AAGMDLAEAVETANAAAALSVQKAG-AAPSMP 292 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 303 Length adjustment: 27 Effective length of query: 289 Effective length of database: 276 Effective search space: 79764 Effective search space used: 79764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory