Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate CCNA_00647 CCNA_00647 nitrate transport ATP-binding protein nrtD
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >FitnessBrowser__Caulo:CCNA_00647 Length = 261 Score = 156 bits (395), Expect = 5e-43 Identities = 84/218 (38%), Positives = 134/218 (61%), Gaps = 12/218 (5%) Query: 2 ATLELRNVNKTYGPGL--PDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISG 59 A L + NV T+ G + L ++LKID GEF+ ++G SGCGKSTL+N +AGL ++ Sbjct: 4 AYLSIENVGVTFAKGSVRSEVLTGVDLKIDKGEFVSIIGHSGCGKSTLLNVVAGLVPVTT 63 Query: 60 GAILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKM-----PTAEIDE 114 GA+++D +++ P D A+VFQ+++L P +SVR+N++ L + K+ AE E Sbjct: 64 GAVILDRQEVNAPGP---DRAVVFQNHSLLPWLSVRENVS--LAVDKVFGGVKSAAERKE 118 Query: 115 EVARVSKLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEM 174 V +L+++ H L ++P ++SGG +QRV + RAL+ PK+ L DEP LDA R + Sbjct: 119 WVLHNLELVKMTHALDKRPAEISGGMKQRVGIARALSMEPKVLLLDEPFGALDALTRAHL 178 Query: 175 RTEMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDG 212 + + +H LK T + +THD EA L D++ +M +G Sbjct: 179 QDSVMEIHSALKNTVLMITHDVDEATLLSDRIVMMTNG 216 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 261 Length adjustment: 27 Effective length of query: 359 Effective length of database: 234 Effective search space: 84006 Effective search space used: 84006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory