Align 2-dehydro-3-deoxygluconokinase (EC 2.7.1.45) (characterized)
to candidate CCNA_01563 CCNA_01563 2-dehydro-3-deoxygluconokinase
Query= BRENDA::Q9WXS2 (339 letters) >FitnessBrowser__Caulo:CCNA_01563 Length = 368 Score = 203 bits (517), Expect = 5e-57 Identities = 135/343 (39%), Positives = 179/343 (52%), Gaps = 17/343 (4%) Query: 5 TFGEIMLRLSPPDHKRIFQTDSFDVTYGGAEANVA-AFLAQMGLDAYFVTKLPNNPLGDA 63 +FGE+MLR P R+ F V GG E NVA AF G + VT LP N LG Sbjct: 20 SFGEVMLRFDP-GFGRVRNARQFQVWEGGGEYNVARAFKKCWGKRSTAVTALPVNDLGWL 78 Query: 64 AAGHLRKFGVKTDYI------ARGGN-RIGIYFLEIGASQRPSKVVYDRAHSAISEAKRE 116 + + GV T +I G N R+G+ F E G RP+ DR HSA S+ + Sbjct: 79 VEDLMMQGGVDTSHIIWRDFDGLGRNTRVGLNFTEKGFGVRPALGCSDRGHSAASQIRPG 138 Query: 117 DFDWEKIL--DGARWFHFSGITPPLGKELPLILEDALKVANEKGVTVSCDLNYRARLWT- 173 + +WEK+ +G RWFH GI L + +A++VA + G VS DLNYRA LW Sbjct: 139 EVNWEKLFGEEGVRWFHTGGIFAALASNTAEAVIEAVEVARKYGTVVSYDLNYRASLWKS 198 Query: 174 ---KEEAQKVMIPFMEYVDVLIANEEDIEKVLGISVEGLDLKTGKLNREAYAKIAEEVTR 230 KE AQKV +YVDV+I NEED LG VEGLD ++ + K+ E + Sbjct: 199 QGGKEGAQKVNRHIAQYVDVMIGNEEDFTACLGFEVEGLDEHISSIDPANFKKMIETAVK 258 Query: 231 KY-NFKTVGITLRESISATVNYWSVMVFENGQPHFSN-RYEIHIVDRVGAGDSFAGALIY 288 ++ NFK TLR + +A+VN WS +++ GQ + S R + I DRVG GD FA L Y Sbjct: 259 QFPNFKVAATTLRNAKTASVNDWSAILYAGGQFYASMMRENLEIYDRVGGGDGFASGLAY 318 Query: 289 GSLMGFDSQKKAEFAAAASCLKHTIPGDFVVLSIEEIEKLASG 331 G + G Q E+ AA L T PGD ++ EE+E + G Sbjct: 319 GFMEGKGPQAAVEYGAAHGALAMTTPGDTSMVRKEEVEAVMKG 361 Lambda K H 0.319 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 21 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 368 Length adjustment: 29 Effective length of query: 310 Effective length of database: 339 Effective search space: 105090 Effective search space used: 105090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory