Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate CCNA_01670 CCNA_01670 sulfate transport ATP-binding protein cysA
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Caulo:CCNA_01670 Length = 339 Score = 208 bits (529), Expect = 2e-58 Identities = 123/321 (38%), Positives = 185/321 (57%), Gaps = 21/321 (6%) Query: 4 IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63 I +++V K F G+ AL+ V++ I +GE +LGPSG+GKTT +R IAGL+ P G++ Sbjct: 3 IAIRSVEKQF--GRYPALNKVDLEIADGELLALLGPSGSGKTTLLRTIAGLEFPDAGQVL 60 Query: 64 FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLT----NMKMSKEEIRK 119 FD + V R++G VFQ +AL+ ++T +NIAF L K SK EI + Sbjct: 61 FDGQDVT-----YASAAARRVGFVFQQYALFKHMTVAKNIAFGLDVRKGKDKPSKAEIAR 115 Query: 120 RVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSA 179 RVEE+ K++++ + +P +LSGGQ+QRVAL+RAL PS+LLLDEPF LDA +R S Sbjct: 116 RVEELLKLVELEGLGGRYPSQLSGGQRQRVALSRALAVQPSVLLLDEPFGALDATVRKSL 175 Query: 180 RALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVAS 239 R ++ V GVT + V+HD + +ADRV +L G++ Q+G P+ ++D P + V Sbjct: 176 RRELRRVHDATGVTTIFVTHDQEEALELADRVAILNNGRIEQIGTPDQVHDAPETAFVCG 235 Query: 240 LIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIG-IRPEDVKLSKDVIKDDSWILVGK 298 +GE N +G+V+ G+L P S D A +RP D L + + +L+ + Sbjct: 236 FVGEANRFDGQVSGGRFKAGALTVPASALKDGAATAYVRPHDFALDEAGFE----VLIER 291 Query: 299 GKVKVIGYQGGLFRITITPLD 319 +V QG L +T D Sbjct: 292 AQV-----QGALTAVTALTSD 307 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 339 Length adjustment: 29 Effective length of query: 324 Effective length of database: 310 Effective search space: 100440 Effective search space used: 100440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory