Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate CCNA_00904 CCNA_00904 inositol ABC transport system, permease protein IatP
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__Caulo:CCNA_00904 Length = 332 Score = 135 bits (341), Expect = 1e-36 Identities = 89/270 (32%), Positives = 142/270 (52%), Gaps = 6/270 (2%) Query: 57 IDILNRAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAGF-----SLPIVL 111 ++IL+ + ++A+GMT VI GGID++VG+++A A A + A + I L Sbjct: 53 LNILSEVSIYGIIAVGMTFVILIGGIDVAVGSLLAFASIAAAYVVTAVVGDGPATWLIAL 112 Query: 112 LSALGTGILAGLWNGILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFG 171 L + G+ G G V L + F+ TL M RG L+ G ++ + W+G Sbjct: 113 LVSTLIGLAGGYVQGKAVTWLHVPAFIVTLGGMTVWRGATLLLNDGGPISGFNDAYRWWG 172 Query: 172 SGSLLFLPTPVIIAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYV 231 SG +LFLP PV+I L + R T G + AVG N AA+ +GVN I Y Sbjct: 173 SGEILFLPVPVVIFALVAAAGHVALRYTRYGRQVYAVGGNAEAARLSGVNVDFITTSVYA 232 Query: 232 LSGLCAAIAGIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALI 291 + G A ++G +++A + A+A AG EL I +VVIGG SL GG + +V+GAL+ Sbjct: 233 IIGALAGLSGFLLSARLGSAEA-VAGTGYELRVIASVVIGGASLTGGSGGVGGTVLGALL 291 Query: 292 IQGMNTGILLSGFPPEMNQVVKAVVVLCVL 321 I ++ G+++ + QVV ++++ + Sbjct: 292 IGVLSNGLVMLHVTSYVQQVVIGLIIVAAV 321 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 332 Length adjustment: 28 Effective length of query: 313 Effective length of database: 304 Effective search space: 95152 Effective search space used: 95152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory