Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate CCNA_02751 CCNA_02751 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02869 (352 letters) >FitnessBrowser__Caulo:CCNA_02751 Length = 332 Score = 150 bits (378), Expect = 6e-41 Identities = 88/242 (36%), Positives = 131/242 (54%), Gaps = 5/242 (2%) Query: 28 AFGSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQIDGVEVGHVA 87 A G H L G+ L VK GE +G SG GKSTL+R I GLE ++G V +DG +V + Sbjct: 12 AQGGHPALSGVSLSVKAGEVFGVIGASGAGKSTLIRLINGLETPSAGQVIVDGDDVAALG 71 Query: 88 PA-----KRGIAMVFQSYALYPHLTVKDNMGLGLKQAGVPKAEIEEKVAKAAGMLSLEPY 142 A +R + M+FQ + L TV N+ LK AG P AE++ + A+ + L + Sbjct: 72 VAGLRALRRRVGMIFQHFNLLSGKTVAQNVAFPLKLAGRPAAEVKARTAELLERVGLSAH 131 Query: 143 LARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIARLHRSLKAT 202 + PA+LSGGQ+QRV I RA+ PK+ L DE S LD IA L+R L T Sbjct: 132 AGKYPAQLSGGQKQRVGIARALATNPKVLLCDEATSALDPETTEQILDLIAGLNRELGLT 191 Query: 203 MIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIGSPQMNFIEAAK 262 ++ +TH+ + D++ VL+AGR+ + G+ E++ PA+ F+ + + A Sbjct: 192 IVLITHEMDVVRRVCDRVAVLDAGRVVEEGAVEEVFLHPASDTARRFVREAEGDVTAAPG 251 Query: 263 LG 264 +G Sbjct: 252 VG 253 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 332 Length adjustment: 29 Effective length of query: 323 Effective length of database: 303 Effective search space: 97869 Effective search space used: 97869 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory