Align Nodulin-26 aquaporin and glycerol facilitator, NIP (de Paula Santos Martins et al. 2015). Transports NH3 5-fold better than water in Hg2+-sensitive fashion (characterized)
to candidate CCNA_01572 CCNA_01572 major intrinsic protein (MIP)-family channel protein
Query= TCDB::P08995 (271 letters) >FitnessBrowser__Caulo:CCNA_01572 Length = 224 Score = 83.2 bits (204), Expect = 4e-21 Identities = 73/221 (33%), Positives = 107/221 (48%), Gaps = 14/221 (6%) Query: 38 QKLVAEAVGTYFLIFAGCASLVVNENYYN---MITFPGIAIVWGLVLTVLVYTVGHISGG 94 ++LVAEA+GT L+ S ++ E + I G + G L VL++ G ISG Sbjct: 8 RRLVAEALGTALLLAVVVGSGIMGERLSDGNIAIALLGNTLATGAALVVLIWVFGPISGA 67 Query: 95 HFNPAVTIAFASTRRFPLIQVPAYVVAQLLGSILASGTLRLLFMGNHDQFSGTVPNGTNL 154 HFNPAVT+ A R PL AY +AQ+LG I T +F Q S + +G + Sbjct: 68 HFNPAVTLVAALRRELPLTLALAYPLAQILGGIAGVWTAHAMFGEPILQVSTKLRSGGD- 126 Query: 155 QAFVFEFIMTFFLMFVICGVATDNRAVGEFAGIAIGSTLLLNVIIGGPVTGASMNP---- 210 QAF E + TF L+ I GV +R E +A+G L + + + NP Sbjct: 127 QAFA-EVVATFGLLATILGV---SRFRPESTPMAVG--LYITAAYWFTASTSFANPAVTV 180 Query: 211 ARSLGPAFVHGEYEGIWIYLLAPVVGAIAGAWVYNIVRYTD 251 ARSL +F ++LA +VGA++ A ++ + TD Sbjct: 181 ARSLSDSFAGIAPASAPAFILAQLVGALSAAALFGWLLKTD 221 Lambda K H 0.323 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 224 Length adjustment: 24 Effective length of query: 247 Effective length of database: 200 Effective search space: 49400 Effective search space used: 49400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory