Align ABC transporter related (characterized, see rationale)
to candidate CCNA_02751 CCNA_02751 ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__Caulo:CCNA_02751 Length = 332 Score = 178 bits (451), Expect = 2e-49 Identities = 107/257 (41%), Positives = 154/257 (59%), Gaps = 14/257 (5%) Query: 9 LSVKNIHKSF--GDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVS 66 ++ +++ K++ G H L G+SL G+V ++GASG+GKST +R +N LETP G V Sbjct: 2 ITFQDVSKTYAQGGHPALSGVSLSVKAGEVFGVIGASGAGKSTLIRLINGLETPSAGQVI 61 Query: 67 LAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKR 126 + G+++ G L+ RR +GM+FQ+FNL S TV +N + P+++ R Sbjct: 62 VDGDDVAAL--GVAGLRALRRR--------VGMIFQHFNLLSGKTVAQN-VAFPLKLAGR 110 Query: 127 SRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALD 186 AE LL +VGL+ G YPA LSGGQ+QRV IARALA +PKV+L DE TSALD Sbjct: 111 PAAEVKARTAELLERVGLSAHAGKYPAQLSGGQKQRVGIARALATNPKVLLCDEATSALD 170 Query: 187 PELVGEVLRVMRSLAEE-GRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVEC 245 PE ++L ++ L E G T++++THEM R V +RV L G+V +G +EVF+ Sbjct: 171 PETTEQILDLIAGLNRELGLTIVLITHEMDVVRRVCDRVAVLDAGRVVEEGAVEEVFLHP 230 Query: 246 KSDRFRQFVSSHQDRTT 262 SD R+FV + T Sbjct: 231 ASDTARRFVREAEGDVT 247 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 332 Length adjustment: 26 Effective length of query: 237 Effective length of database: 306 Effective search space: 72522 Effective search space used: 72522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory